DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and TDRD5

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001186014.1 Gene:TDRD5 HGNCID:20614 Length:1035 Species:Homo sapiens

Alignment Length:694 Identity:151/695 (22%)
Similarity:248/695 (36%) Gaps:186/695 (27%)


  Fly    10 VKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTV-TGHGQMAW 73
            ::|.:.||::|:...|:.::|.::|....|..||...||::.....:..:||.|.| .|.|....
Human    11 LRKEIRSLLISTKDGLSPQELEKEYLLMVGNHLPLRILGYRSTMELVLDMPDVVRVCPGAGGTVI 75

  Fly    74 ITAVATAKSAHIQKLVRCQKKS-KNRGS-HKPKYCYASEPSNLVFINESVSKMKNRKAPFPTYQV 136
            :.|:....:..|..||..|:.| |.|.| ||.:....|.|.:    :..| ..:.|.||.....|
Human    76 LKAIPDESTKGIASLVAKQRSSHKLRNSMHKGRPSIYSGPRS----HRRV-PYRGRVAPILPAVV 135

  Fly   137 PRNLK-----LPV-----------------SYPNYNRL-LYPVHTPHIDQMISTGQQQS------ 172
            ...||     .||                 .|..|..| ::.|.....| :||..|.::      
Human   136 KSELKDLLALSPVLLSDFEKAFAKRFGRSFQYMQYGFLSMFEVLNAASD-VISVEQTRAGSLLML 199

  Fly   173 --------------------TLRTQRPSF--------PCNANSKSLKVNDWSQKDRKQEPSKE-R 208
                                ..|.::.|:        ||           :||.....||.|: .
Human   200 KKSVTEEKPRGCPAGKIFTQPFRMKQGSYSTGFPVAKPC-----------FSQPTSNMEPPKQIM 253

  Fly   209 NNQKYPKI-TTENKQEKETEELAQ---AFENLSVDVAP-----TDHQEKLKCEIYEDNEDEFVRD 264
            :.:|..|: ..|..:...||:|.|   .|:::...:.|     ::.:.|:|..:.:..|..|:..
Human   254 SMEKTSKLNVVETSRLNHTEKLNQLENTFKSVIAQIGPGGTISSELKHKIKFVVSKFPEGLFISK 318

  Fly   265 PFIYGE-------------------------------VKEKEDEAVVLAFDAVSEDGFDLLSMTT 298
              :.||                               |:.::....:|.|||   |...|..:.:
Human   319 --LLGEYEVIFKEQLSPKKLGFLNVTELVGALSDILHVEFRKGHQDLLVFDA---DKKPLPPVQS 378

  Fly   299 TQQNAVKPL--DPPEDCLHYA----------SSDDGEDENAI---PAYAVDHRVLDV-------- 340
            .::...|..  .||.:.|..|          |....|.:..|   |...|....|.|        
Human   379 DKKIEAKACVSSPPRNSLSTAAVKETVWNCPSKKQKEPQQKICKKPNLVVKPLQLQVETNKSELN 443

  Fly   341 ------DYPRDAV--RSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDFKD-YEAQ 396
                  |.|.|||  :....||..|..|:      |.|.:..:::|..|...||:.|..: .|..
Human   444 LAMANHDIPPDAVPNKKLCRLPPLDTSSL------IGVFVEYIISPSQFYIRIYSRDSSELLEDM 502

  Fly   397 FANMQTFYESS-ESKNYTMPLFLITTDHLCVVRCTSG--WERA---KVLGYRSSNNKMTIEVELV 455
            ...|:..|.:. .|..|.||...|...|||.||.:..  |.|.   :||      .|..:||...
Human   503 MIEMRRCYSNQLVSDRYVMPECFIQPGHLCCVRISEDKWWYRVIIHRVL------EKQEVEVFYP 561

  Fly   456 DIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVE 520
            |.|:|..|.:.:::||...:..||.|.:...||::...:. :||::.:..|..:..|:.|...|:
Human   562 DFGNIGIVQKSSLRFLKCCYTKLPAQAIPCSLAWVRPVEE-HWTSKAILQFQKLCGLKPLVGVVD 625

  Fly   521 AIKNNTAYLVLVDTES------------QGHTVNLNRSLIETGW 552
            ...:....:.|.||.|            :||.:....::...|:
Human   626 EYVDGILNIFLCDTSSNEDVYFHHVLRTEGHAIVCRENISSKGF 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 23/84 (27%)
TUDOR 379..488 CDD:278965 34/116 (29%)
TDRD5NP_001186014.1 LOTUS_1_TDRD5 4..98 CDD:193599 24/87 (28%)
LOTUS_2_TDRD5 132..201 CDD:193589 13/70 (19%)
LOTUS_3_TDRD5 296..369 CDD:193590 11/78 (14%)
TUDOR 471..594 CDD:278965 38/135 (28%)
TUDOR 529..575 CDD:119391 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4959
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1115068at2759
OrthoFinder 1 1.000 FOG0005690
OrthoInspector 1 1.000 T1072231
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22948
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.