DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and TDRD15

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001293066.1 Gene:TDRD15 HGNCID:45037 Length:1934 Species:Homo sapiens

Alignment Length:571 Identity:100/572 (17%)
Similarity:218/572 (38%) Gaps:116/572 (20%)


  Fly     3 DGGELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVT- 66
            ||....|:.:::.......|      .|::..|       |...||.||....::.:.|.:..: 
Human   186 DGDSFRLIVEMLEEFPQQMP------DLLQHKR-------PELSLGNKDTSLDIQHVLDKLQPSL 237

  Fly    67 --GHGQMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKY----CYASEPSNLVFINESVSKMK 125
              |..:...:::..:....:.| |::...:.:|..:|...:    |..:.|:...|....|::.:
Human   238 SVGSTESVKVSSALSPSKFYCQ-LIKWTPELENLTAHMTLHYDTVCQETSPTCDNFGLLCVARRR 301

  Fly   126 NRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVH--TPHIDQMISTGQQQSTLRTQRPSFPCNANSK 188
            |.       |..|.:...:..||..::.:..:  :..|..:.....:|..:.....||||:    
Human   302 NG-------QWHRGILQQLLPPNQVKIWFMDYGSSEAIPSIYVKKLKQDFILVPLFSFPCS---- 355

  Fly   189 SLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEI 253
                                       :|..:..:::    |:.|: ||:      .::.|..::
Human   356 ---------------------------LTCLHSPDRD----ARIFQ-LSI------FKQALLGQV 382

  Fly   254 YEDNEDEFVRDPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPE--DCLHY 316
            ...:.|.|.:|..:|....:.::..|         :...||....||  .:.|:...:  :.|..
Human   383 VYAHIDWFNKDECLYYVTLQTQESTV---------NSKCLLKTVGTQ--VLCPMSDSKISNILSE 436

  Fly   317 ASSDDGEDENAIPAYAVDHRVLDVDYPRDAVRSAFTL----PARDIESIIELQQRIRVQLVSLVN 377
            .|..|      :.::||:..:.::::..|::.....|    |.:.::  :|::......:..::|
Human   437 TSVSD------VNSFAVESFMGNIEWSIDSLNKKGILKVGFPIKTVQ--MEIEAAYIAFIAYVLN 493

  Fly   378 PHNFNFWI-YNDDFKDYEAQFANMQTFYESSESKNYTMPLFLITTDHLCVVRCTSG--WERA--- 436
            |.  |||: .||...:::....|:..||:..|  |..|.|........|..|.:..  :.||   
Human   494 PS--NFWVRTNDHRNEFQEIMKNINKFYDLCE--NDEMILRKPEPGLFCCARYSKDRRFYRAVIT 554

  Fly   437 KVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAE 501
            ::.||:       |.|..:|.|:...:...:||.|:..|..||...:...||.|...:. .||..
Human   555 EINGYK-------INVYFLDYGNTDSIPFFDVKILLPEFCELPALAMCCSLAHIFPVED-LWTKA 611

  Fly   502 VVNFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGW 552
            .:::|..::|.:.:..:|.| |.:..|.|.:.:......:::...:::.|:
Human   612 AIDYFKKLVLNKAILLQVIA-KKDDKYTVNIQSVEASENIDVISLMLQAGY 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 13/89 (15%)
TUDOR 379..488 CDD:278965 29/115 (25%)
TDRD15NP_001293066.1 TUDOR 237..356 CDD:278965 20/158 (13%)
TUDOR 293..339 CDD:119391 7/53 (13%)
TUDOR 479..600 CDD:278965 33/132 (25%)
TUDOR 535..580 CDD:119391 11/52 (21%)
TUDOR 759..867 CDD:278965
TUDOR 806..848 CDD:119391
TUDOR 961..1084 CDD:278965
TUDOR 1017..1062 CDD:119391
TUDOR 1291..1412 CDD:278965
TUDOR 1346..1393 CDD:119391
TUDOR 1524..1641 CDD:278965
TUDOR 1578..1624 CDD:119391
TUDOR 1740..1852 CDD:278965
TUDOR 1784..>1820 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.