DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Tdrd7

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001277404.1 Gene:Tdrd7 MGIID:2140279 Length:1119 Species:Mus musculus

Alignment Length:688 Identity:148/689 (21%)
Similarity:257/689 (37%) Gaps:210/689 (30%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTV--TGH 68
            |..||.|::.:::.|....:.:.:|..:|||..|..:|:.:||:...|::|||:|..|.:  :..
Mouse    36 EADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRS 100

  Fly    69 GQMAWITAVATAKSAHIQKLVRCQKKSKNRGSH------------------KPK----------- 104
            |::. ..|||..::|.|.:||..|:.||.:...                  |||           
Mouse   101 GEIV-CYAVACTETARIAQLVARQRTSKRKIGRQINCQMRVKKAMPFFLEGKPKATLRQPGFASD 164

  Fly   105 YCYASEPSNLVFINESVS---KMKNRKAPFPTYQVPRNL------------KLPVSYPNYNRLLY 154
            |..:.:|::.:..:...:   |......|:|...|.|:.            .||.|:..      
Mouse   165 YSISRKPNSALLRDRGSALGVKADVDMPPYPDTPVQRHASMSANSRFSPKSSLPASFQT------ 223

  Fly   155 PVHTPHIDQMISTGQQQSTLRT-QRPSF--PCNANSKSLKVNDWSQKDRKQEPSKERNN----QK 212
                 ||.:...|....:..:| ::|:.  |.:..:|..:|     ::|.:|...:.||    .|
Mouse   224 -----HISRACPTEVNDNLNQTVEKPNITPPASYTNKMDEV-----QNRIKEILDKHNNGIWISK 278

  Fly   213 YPKITTENKQEKETEELAQAFEN----LSVD----------VAPTDHQEKLKCEIYEDNEDEF-- 261
            .|....|..:|...:.:.|.||:    .:|:          :.|...::.||.:  :|.|.|.  
Mouse   279 LPHFYKEFYKEDLNQGVLQQFEHWPHICTVEKPCGGGQDSLLYPARREQPLKSD--QDPEKELPP 341

  Fly   262 -----------VRDPFIYGEVKEKEDE------------AVVLAFDAVSEDGFDLLSMTTTQQNA 303
                       ...|.:..:||||..|            |:..||:.:.:..|            
Mouse   342 PPPAPKQEVPSQGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFEDMYKVKF------------ 394

  Fly   304 VKPLDPPEDCL-HYASSDD--------GEDENAIPAYAVDHRVLDVDYPRDAV-------RSAFT 352
                  |||.| :.||..|        |..:.|| .||      .:..|.|.:       :..| 
Mouse   395 ------PEDALKNLASLSDVCTINYISGNTQKAI-LYA------KLPLPTDKILKDEGQAQGDF- 445

  Fly   353 LPARDIESIIELQQRIRVQ---------------------------LVSLVNPHNFNFWIYNDDF 390
                ||:|:|| |:.::::                           .|.:|...|.|..:.....
Mouse   446 ----DIKSMIE-QEYLQIEKNMAESADEFLEDITVPPLVIPTEASPSVLVVELSNTNDVVIRYVG 505

  Fly   391 KDYEAQFANMQTFYESSESKN-YTMPLFLITTDHLCVVRC-TSGWERAKVLGYRSSNNKMTIEVE 453
            |||.|....|:...:...||| ...|:..:....|..|.. ...|.||:::    |.::..|:|.
Mouse   506 KDYSAAQELMEDEMKEFYSKNPRVTPIQTVHVGQLLAVNAEEDAWLRAQII----STDENKIKVC 566

  Fly   454 LVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAF-ITQCKSPNWTAEVVNFFHDMI--LLRLL 515
            .||.|....:.:.      |.:.|.||.|   .|:| .|:||...  .||:|...|::  :..|.
Mouse   567 YVDYGFCENIEKS------KAYRLNPRFC---SLSFQATKCKLAG--LEVLNDDPDLVKAVESLT 620

  Fly   516 YAKVEAI----KNNTAYLVLVDTESQGHTVNLNRSLIE 549
            ..|:.|:    |::...:||.||..: ..:|:|.:.::
Mouse   621 CGKIFAVEILDKSDVPLVVLYDTSGE-DDININATCLK 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 27/88 (31%)
TUDOR 379..488 CDD:278965 28/111 (25%)
Tdrd7NP_001277404.1 LOTUS_1_TDRD7 38..124 CDD:193600 27/87 (31%)
LOTUS_2_TDRD7 256..322 CDD:193587 13/71 (18%)
LOTUS_3_TDRD7 361..425 CDD:193588 20/83 (24%)
TUDOR 480..602 CDD:278965 34/135 (25%)
TUDOR 538..580 CDD:119391 11/52 (21%)
TUDOR 669..796 CDD:278965
TUDOR 728..773 CDD:119391
TUDOR 932..1047 CDD:278965
TUDOR 984..1028 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.