DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and LHT2

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_564217.1 Gene:LHT2 AraportID:AT1G24400 Length:441 Species:Arabidopsis thaliana

Alignment Length:434 Identity:101/435 (23%)
Similarity:172/435 (40%) Gaps:69/435 (16%)


  Fly   144 FQAAWNVTNAIQGMFIVSLPFAVLHGGYW--AIVAMVGIAHICCYTGKVLVQCLYEPDPATGQMV 206
            :.|..||| |:.|..::|||:|:.:.| |  .:..||....|..||...:|: ::|..|  |:.:
plant    35 YSAFHNVT-AMVGAGVLSLPYAMSNLG-WGPGVTIMVMSWIITLYTLWQMVE-MHEIVP--GKRL 94

  Fly   207 RVRDSYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDLLAGTYPQGSFDSRS-----W 266
               |.|..:.:..||.|||...|...|||..:...|:|:|..|..|...:.....|.:.     |
plant    95 ---DRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGGASLKKVHQLVCPDCKEIRTTFW 156

  Fly   267 -MLFVGIFLLPMGFLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQIGDWGWS-----------K 319
             |:|..:..          ::|.|..:.::|.|.:.|.::......|. |..|           .
plant   157 IMIFASVHF----------VISHLPNFNSISIISLAAAVMSLTYSTIA-WAASVHKGVHPDVDYS 210

  Fly   320 VRFSIDME---NFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLD-W-----SHIAAAVFKA 375
            .|.|.|:.   ||..:||.:.|:|.....:..::..:....:....:. |     ::|..|:...
plant   211 PRASTDVGKVFNFLNALGDVAFAYAGHNVVLEIQATIPSTPEMPSKVPMWRGVIVAYIVVAICYF 275

  Fly   376 GFGYICFLTFQNDTQQVITNNLHSQ-GFKGMVNFFLVIKALLSY---PLPYYAACE--LLERNFF 434
            ...::.:..|.|.....|...|... ....|.|.|:||..:.||   .:|.:...|  |:::..|
plant   276 PVAFLGYYIFGNSVDDNILITLEKPIWLIAMANMFVVIHVIGSYQIFAMPVFDMLETVLVKKMNF 340

  Fly   435 RGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTILMAIFIPHFSILMGFIGSFTGTMLSFIWPCY 499
            ....|.:|.|               |...:..|:::||.:|.|..|:||.|.|.....::..||.
plant   341 NPSFKLRFIT---------------RSLYVAFTMIVAICVPFFGGLLGFFGGFAFAPTTYYLPCI 390

  Fly   500 FHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIG-IYDSGNALINA 542
            ..:.:|...........::..|.:|||..::. |......:|||
plant   391 MWLVLKKPKRFGLSWTANWFCIIVGVLLTILAPIGGLRTIIINA 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 98/424 (23%)
SdaC 159..539 CDD:223884 92/415 (22%)
LHT2NP_564217.1 Aa_trans 29..425 CDD:279788 98/424 (23%)
SdaC 44..427 CDD:223884 93/416 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D570025at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.