DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and AT5G16740

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_197176.1 Gene:AT5G16740 AraportID:AT5G16740 Length:426 Species:Arabidopsis thaliana

Alignment Length:442 Identity:99/443 (22%)
Similarity:178/443 (40%) Gaps:77/443 (17%)


  Fly   123 ASEGSSFVCEGEGGGGCKIDEFQAAWNVTNAIQGMFIVSLPFAVLHGGYWAIVAMVGIAHICCYT 187
            |||.|||:              .:..|:...:.|:..:|:|:||..||:.:|..::....:..||
plant    29 ASENSSFL--------------HSVINMVGMLIGLGQLSMPYAVESGGWMSIFLLISFGILTTYT 79

  Fly   188 GKVLVQCLYEPDPATGQMVRVRDSYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDLL 252
            ..:|.:|: ..:|.:       .||..|....|| :.|...|.:...:|:.|..:.|.:...|.:
plant    80 SHILGKCI-RRNPKS-------KSYSDIGYSAFG-RHGRLIVCLFIYLEIFMALVSYTISLHDNI 135

  Fly   253 AGTYP-----QGSFDSRSWMLFVGIFLLPMGFLKSLKMVSTLSFWCTMSHIVINAVILG---YCL 309
            :..:|     .|.|.:...........||..:::.|..:|.||    ...|:::|:|.|   |..
plant   136 SAAFPATFSNHGHFPAAKLTAVAVAIALPSLWIRDLSSISFLS----SGGILMSAIIFGSVVYTA 196

  Fly   310 LQIG--DWGWSKVRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLDWSHIAAAV 372
            :..|  |.|...|   :.:||.|...|:.:||:...|..|.|..:|.|.|||..:   |.::.|.
plant   197 IFGGVIDDGKIPV---LRLENIPTVSGIYLFSFGGHIVFPNLYTSMKDPSKFTKV---SIVSFAT 255

  Fly   373 FKAGFGYICF-------------LTFQNDTQQVITNNLHSQGFKGMVNFFLVIKALLSYPLPYYA 424
            ..|.:|.:..             :|.......|:|.         :..:..|:..:..|.|.:..
plant   256 VTALYGALAITGAKMFGPSVNSQITLSLPKHLVVTK---------IALWATVLTPMTKYALEFAP 311

  Fly   425 ACELLERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTIL-MAIFIPHFSILMGFIGSFT 488
            ....|||:.    |.|       :....|:...|.....::..|| :|:.:|:|..::...||..
plant   312 LAIQLERSL----PST-------MTDRTKLVARGLMGSALLLVILALALTVPYFGYVLSLTGSLV 365

  Fly   489 GTMLSFIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIGIYDSGNALI 540
            ...::...|..|::||....:.:...|.:...:.||.:.||:|.::|...|:
plant   366 SVTIAVTLPSAFYLKICWDGMTKFTRAANLGFVVLGCVLGVLGSFESSKLLV 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 91/413 (22%)
SdaC 159..539 CDD:223884 90/404 (22%)
AT5G16740NP_197176.1 SLC5-6-like_sbd 32..409 CDD:320982 94/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I1763
OMA 1 1.010
OrthoDB 1 1.010 D570025at2759
OrthoInspector 1 1.000 T125107
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
55.170

Return to query results.
Submit another query.