DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and LHT7

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_567977.2 Gene:LHT7 AraportID:AT4G35180 Length:478 Species:Arabidopsis thaliana

Alignment Length:536 Identity:113/537 (21%)
Similarity:195/537 (36%) Gaps:157/537 (29%)


  Fly    58 MEAGMDGGDTTEMSSNPFRNAGSWTNDGEGGGDGDGEYRNEYQSTSFNEYDGRYQQTDGF----- 117
            :|:...||....||..|..:....:.: :.||||                 ||....:..     
plant    11 LESQESGGSPLFMSPAPSTDPQPISGE-KNGGDG-----------------GRIPVEEWLPITES 57

  Fly   118 RQGSIASEGSSFVCEGEGGGGCKIDEFQAAWNVTNAIQGMFIVSLP--FAVLHGGYW-AIVAMVG 179
            |:|::.:.....:|.|                     .|:.::.||  ||.| |..| .|:..||
plant    58 RKGNVYTATFHLLCSG---------------------IGLQVILLPAAFAAL-GWVWGTIILTVG 100

  Fly   180 IAHICCYTGKVLVQCLYEPDPATGQMVRVRDSYVAIAKVCFGPKLG------------------- 225
            ... ..||..:||| |:|..|.    :|: ..||.:|...||.|||                   
plant   101 FVW-KLYTTWLLVQ-LHEAVPG----IRI-SRYVRLAIASFGVKLGKLLGIFPVMYLSGGACTIL 158

  Fly   226 --ARAVSIAQLIELL----------MTCILYVVVCGDLLAGTYPQGSFDSRSWMLFVGIFLLPMG 278
              ....||.||::::          :.|.| |..|..::...:|  :.:|...:..:|.|   ||
plant   159 VITGGKSIQQLLQIMSDDNTAPLTSVQCFL-VFSCIAMIMSQFP--NLNSLFGVSLIGAF---MG 217

  Fly   279 FLKSLKMVSTLSFWCTMSHIVINA-------VILGYCLLQIGDWGWSKVRFSIDMENFPISLGVI 336
            ..           :||:..|:..|       |.:.|..:.         :..:.:.|   ::|:|
plant   218 IA-----------YCTVIWILPVASDSQRTQVSVSYATMD---------KSFVHIFN---AIGLI 259

  Fly   337 VFSYTSQIFLPTLEGNMIDRS-----KFNW---MLDWSHIAAAVFKAGFG-YICFLTFQNDTQQV 392
            ...|.....:..::|.:...|     |..|   |:..:.:|..:|...|. |..:......|...
plant   260 ALVYRGNNLVLEIQGTLPSDSKNPSCKTMWRAVMISHALVAICMFPLTFAVYWAYGDKIPATGGP 324

  Fly   393 ITNNL------HSQGFKGMVNFFLVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGE 451
            :.|.|      ||:.....::...:...|.|||:....||:.:|..:.   .|.|.|....:...
plant   325 VGNYLKLYTQEHSKRAACFIHLTFIFSCLCSYPINLMPACDNIEMVYI---TKKKKPASIIVRMM 386

  Fly   452 LKVWGLGFRVGVIVSTILMAI-FIPHFSILMGFIGSFTGTMLSFIWPCYFHIKIKGHLLDQKEIA 515
            |:|:     :.::..||.:.. |:|:.::|:|.|    ..:::|.:||:..|.||      |...
plant   387 LRVF-----LSLVCFTIAVGFPFLPYLAVLIGAI----ALLVTFTYPCFMWISIK------KPQR 436

  Fly   516 KDYLIIGLGVLFGVIG 531
            |..:.: ..||.|.:|
plant   437 KSPMWL-FNVLVGCLG 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 97/446 (22%)
SdaC 159..539 CDD:223884 96/431 (22%)
LHT7NP_567977.2 SLC5-6-like_sbd 58..462 CDD:294310 101/472 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.