DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and slc32a1

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001074170.1 Gene:slc32a1 ZFINID:ZDB-GENE-061201-1 Length:530 Species:Danio rerio

Alignment Length:469 Identity:220/470 (47%)
Similarity:302/470 (64%) Gaps:11/470 (2%)


  Fly    83 NDGEGGGDGDGEYRNEYQSTSFNEYDGRYQQTDGFRQGSIASEGSSFVCEGEGGGGCKIDEFQAA 147
            || |.||:|.||...:    ...|.|..||: ||......||:......|.......:|..::|.
Zfish    69 ND-EMGGEGGGEMGED----GMAEGDSHYQR-DGTGPPPSASKDGGLCSEIGNPDKPRITAWEAG 127

  Fly   148 WNVTNAIQGMFIVSLPFAVLHGGYWAIVAMVGIAHICCYTGKVLVQCLYEPDPATGQMVRVRDSY 212
            |||||||||||::.||:|:|||||..:..::..|.:||||||:|:.|||| :...||:|||||||
Zfish   128 WNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYE-ENEDGQLVRVRDSY 191

  Fly   213 VAIAKVCFGPK---LGARAVSIAQLIELLMTCILYVVVCGDLLAGTYPQGSFDSRSWMLFVGIFL 274
            |.||..|..|:   ||...|::||:|||:|||||||||.|:|:..::|......|||.:.....|
Zfish   192 VDIANACCAPRFPALGGHVVNVAQIIELVMTCILYVVVSGNLMYNSFPTLPVSQRSWAIIATAAL 256

  Fly   275 LPMGFLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQIGDWGWSKVRFSIDMENFPISLGVIVFS 339
            ||..|||:||.||..|..||::|.|||.:::.|||.:..||.|.||:|.||::.||||:|:||||
Zfish   257 LPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWDKVKFYIDVKKFPISIGIIVFS 321

  Fly   340 YTSQIFLPTLEGNMIDRSKFNWMLDWSHIAAAVFKAGFGYICFLTFQNDTQQVITNNLHSQGFKG 404
            ||||||||:|||||...|:|:.|::|:||||.:.|..|..:.:||:.::|::|||:||.| ..:.
Zfish   322 YTSQIFLPSLEGNMQKPSEFHCMMNWTHIAACILKGLFALVAYLTWADETKEVITDNLPS-SIRA 385

  Fly   405 MVNFFLVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTIL 469
            :||.|||.|||||||||::||.|:||:.||:...:..||..:..||.||.|||..|..::|.|:|
Zfish   386 VVNLFLVSKALLSYPLPFFAAVEVLEKTFFQDGGRAFFPDCYGGDGRLKSWGLSLRCALVVFTML 450

  Fly   470 MAIFIPHFSILMGFIGSFTGTMLSFIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIGIYD 534
            |||::|||::|||..||.||..|.|:.|..||:|:....|...::..|..|..:|.:..:.|...
Zfish   451 MAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLKLLWRKLLWHQVFFDVAIFVIGGICSISGFIH 515

  Fly   535 SGNALINAFEIGLP 548
            |...||.|::..||
Zfish   516 SVEGLIEAYKYNLP 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 196/392 (50%)
SdaC 159..539 CDD:223884 185/383 (48%)
slc32a1NP_001074170.1 Aa_trans 120..517 CDD:279788 198/399 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96874993
eggNOG 1 0.900 E1_COG0814
Hieranoid 1 1.000
Homologene 1 1.000 H56451
Inparanoid 1 1.050 424 1.000 Inparanoid score I1705
OMA 1 1.010
OrthoDB 1 1.010 D321223at33208
OrthoFinder 1 1.000 FOG0003676
OrthoInspector 1 1.000 T1051687
orthoMCL 1 0.900 OOG5_128762
Panther 1 1.100 LDO PTHR22950
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2046
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.