DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and CG43693

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001261694.1 Gene:CG43693 FlyBaseID:FBgn0263776 Length:572 Species:Drosophila melanogaster

Alignment Length:613 Identity:124/614 (20%)
Similarity:215/614 (35%) Gaps:167/614 (27%)


  Fly    11 PLPPLRNILNVAVQTARQQIPER----------KDYEQPPGSTAQQH-HHSQQAQHKAMEAGMDG 64
            ||||           .|:|:.|:          .......||..:|| ..:..|:||...:...|
  Fly    15 PLPP-----------RREQLTEKGQSLSLSSFGGSAGNISGSGRKQHLSGAALARHKLKMSLKRG 68

  Fly    65 GD-----------TTEMSSN--PFRNAGSWTNDGEGGGDG-----------DGEYRNEYQST--- 102
            |.           ||.:...  |...||...|:...||.|           |...:....||   
  Fly    69 GPPPVATSGSGVMTTSLDQQKIPTVTAGYGENEKPKGGKGGQSKFIRSDMADVPVQQAAGSTLPL 133

  Fly   103 ------SFNEYDGRYQQTDGFRQGSIASEGSSFV--CEGEGGGGCKIDEFQAAWNVTNAIQGMFI 159
                  ..:..||.|...:..:.....|:..:||  .:|..|.|                    |
  Fly   134 VISRKKGDDSEDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSG--------------------I 178

  Fly   160 VSLPFAVLHGGYW-AIVAMVGIAHICCYTGKVLVQCLY-----EPDPATGQMVRVRDSYVAIAKV 218
            :::|.|..|.|.| .:||...:..:|.|...:||:|.:     ...|..|        :..:|:.
  Fly   179 LAMPMAFSHAGLWFGLVATFAVGTLCTYCVHILVKCAHILCRRRKIPMMG--------FADVAEQ 235

  Fly   219 CF--GPKLGAR-------AVSIAQLIELLMTCILYVVVCG---DLLAGTYPQGSFDSRSWMLFVG 271
            .|  ||....|       .|:...:|:||..|.:|:|...   :.:...|.:.....|.|::.|.
  Fly   236 AFLDGPPALNRWSRFIRFMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETELSIRVWIMIVT 300

  Fly   272 IFLLPMGFLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQIGDWGWSKVRFS-----------ID 325
            ..|:.|..:::||.::..|....:  ::...:::.:..:           ||           :.
  Fly   301 APLIFMCLVRNLKFLTPFSMIANI--LMFVGIVITFIYM-----------FSDIPAPVERPGIVS 352

  Fly   326 MENFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLDWSHI--AAAVFKAGFGYIC------- 381
            :..:|:..|.::|:         |||..:..|..|.|.:.||.  ..:|...|.|.:.       
  Fly   353 VTEWPLFFGTVIFA---------LEGIGVVMSLENDMKNPSHFIGCPSVLNFGMGLVIALYTLVG 408

  Fly   382 ---FLTFQNDTQQVITNNLHSQG-FKGMVNFFLVIKALLSYPLPYYAACELLERNFFRGPPKTKF 442
               ||.:..:||..||.||..:. ....|...:.|....::.|.:|....:|    ::|......
  Fly   409 FFGFLKYGPETQASITLNLPLEDKLAQSVKLMIAIAIFFTFTLQFYVPVTIL----WKGLEHKIR 469

  Fly   443 PTIWNLDGELKVWGLGFRVGVIVSTILMAIFIPHFSILMGFIGSFTGTMLSFIWPCYFHIKI--- 504
            |...|:.      ..|.||.:::....:|:.:|:....:..||:...:.|..|.|....:.:   
  Fly   470 PEKQNIS------EYGLRVFLVLLCGGIAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYHE 528

  Fly   505 -KGHLLDQKEIAKDYLIIGLGVLFGVIG 531
             .|:......:.|:   .|| :||||:|
  Fly   529 DPGYGRFNWRLWKN---SGL-ILFGVVG 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 87/435 (20%)
SdaC 159..539 CDD:223884 87/420 (21%)
CG43693NP_001261694.1 SdaC 153..561 CDD:223884 93/465 (20%)
SLC5-6-like_sbd 158..562 CDD:294310 93/460 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22950
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.