DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and CG13743

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_610444.2 Gene:CG13743 FlyBaseID:FBgn0033368 Length:528 Species:Drosophila melanogaster

Alignment Length:578 Identity:131/579 (23%)
Similarity:229/579 (40%) Gaps:155/579 (27%)


  Fly     2 SFIAKLKATPLPPLRNILNVAVQTARQQ-IPER--KDYEQPPGSTAQQHH--HSQQAQHKAMEAG 61
            |.::..:|.......||:....||.:|| .|::  :..:|||....||.|  ||||.|....:||
  Fly    25 SDVSVAEAYAFDDFNNIMKNNHQTHQQQGQPQQPHQQQQQPPQQQQQQQHRQHSQQQQQAQQDAG 89

  Fly    62 MDGGDTTEMSSNPFRNAGSWTNDGEGGGDGDGEYRNEYQSTSFNEYDGRYQQTDGFRQGSIASEG 126
            :  |||  :||.|                                                    
  Fly    90 L--GDT--LSSLP---------------------------------------------------- 98

  Fly   127 SSFVCEGEGGGGCKIDEFQAAWNVTNAIQGMFIVSLPFAVLHGGY-WAIVAMVGIAHICCYTGKV 190
                              ||::|..|:|.|..::.:|:|:...|: ..:..::.:|:|..|:..:
  Fly    99 ------------------QASFNYINSIVGSGVIGIPYALHRAGFGLGLALLILVAYITDYSLIL 145

  Fly   191 LVQCLYEPDPATGQMVRVRDSYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDLLAGT 255
            :|:|.:         :..|.||..|.:..:| |.|...:|:.|.:...:..|.|.||.||.|:..
  Fly   146 MVRCGH---------ICGRFSYPGIMEAAYG-KYGYYLLSLLQFMYPFLAMISYNVVVGDTLSKV 200

  Fly   256 ----YPQ--GSFDS-RSWMLF---VGIFLLPMGFLKS---LKMVSTLSFWCTMSHIVINAVILGY 307
                :|.  ||..: |..::|   ||: ::|:...|:   |...|.:|..|.:  .::.|||:  
  Fly   201 LVRFFPSWGGSMGAVRLGVVFFVNVGV-VMPLCLYKNVSRLARASFISLACVV--FILFAVII-- 260

  Fly   308 CLLQIGDW-------GWSKVRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLDW 365
             .|..||:       .|   ||: :.:..| :.|::||::........:..:|.|.:...|. ..
  Fly   261 -KLMSGDYKVTDTAESW---RFA-NSDLIP-ATGIMVFAFMCHHNTFLVYQSMRDATMERWE-KV 318

  Fly   366 SHIA---AAVFKAGFGYICFLTFQNDTQQVITNNLHSQGFKGMVNFFLV---IKALLSYPLPYYA 424
            :||:   |....|.||...:.||:..:|..:..|....  ..::||..|   |..||::|:..:.
  Fly   319 THISIGFAWTVAALFGIAGYSTFRALSQGDLLENYCWD--DDLMNFSRVLFSISILLTFPIECFV 381

  Fly   425 ACEL---LERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIV----STILMAIFIPHFSI--- 479
            :.|:   |...|....|.::|..  :.|..|:       .|.|:    ..|.|||....|.|   
  Fly   382 SREIVRALVHRFVLKEPISEFTQ--DKDPSLE-------KGAIIDEYSKAITMAIVFSAFVISPM 437

  Fly   480 --LMGFIGSFTGTM----LSFIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIG 531
              .:|.:....|.:    |::|.|...:|:::.|.|..:|......::..|.|..::|
  Fly   438 TDCLGSVLELNGLLAAIPLAYILPGLAYIQMEPHALLSREKLPALGLVVFGALVTILG 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 103/432 (24%)
SdaC 159..539 CDD:223884 97/417 (23%)
CG13743NP_610444.2 SLC5-6-like_sbd 95..500 CDD:294310 106/505 (21%)
SdaC 95..491 CDD:223884 105/499 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97760741
eggNOG 1 0.900 E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22950
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.