DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VGAT and CG13384

Sequence 1:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_723383.1 Gene:CG13384 FlyBaseID:FBgn0032036 Length:504 Species:Drosophila melanogaster

Alignment Length:596 Identity:125/597 (21%)
Similarity:210/597 (35%) Gaps:165/597 (28%)


  Fly    12 LPPLRNILNVAVQTARQQIPE---RK----------------DYEQPPGSTAQQHHHSQQAQHKA 57
            |.||.|:         |||||   ||                |||...||.|:....|..     
  Fly     4 LTPLTNL---------QQIPEGAPRKKKMTERQPLLLQSDASDYEGSRGSAARPVRSSPP----- 54

  Fly    58 MEAGMDGGDTTEM---SSNPFRNAGSWTNDGEGGGDGDGEYRNEYQSTSFNEYDGRYQQTDGFRQ 119
                    |.|.:   |.:....:||       |.|..|.....|..|...:.:   ..|..|  
  Fly    55 --------DNTLVNVHSEDSLAASGS-------GDDEIGSTDKSYNPTHHRDLE---HPTSNF-- 99

  Fly   120 GSIASEGSSFVCEGEGGGGCKIDEFQAAWNVTNAIQGMFIVSLPFAVLHGG-YWAIVAMVGIAHI 183
                 :....:.:|..|.|                    |:::|.|..:.| |..:...:.:..|
  Fly   100 -----DTLVHLLKGNIGTG--------------------ILAMPDAFKNAGLYVGLFGTMIMGAI 139

  Fly   184 CCYTGKVLVQCLYE-----PDPATGQMVRVRDSYVAIAKVCFGPKLGARAVSIAQLIELLMTCIL 243
            |.:...:||.|.:|     ..|:      :..|.||......|| ||.|..|:  |...::|..|
  Fly   140 CTHCMHMLVNCSHELCRRFQQPS------LDFSEVAYCSFESGP-LGLRRYSM--LARRIVTTFL 195

  Fly   244 YVVVCG--------------DLLAGTYPQGSFDSRSWMLFVGIFLLPM---GFLKSLKMVSTLSF 291
            ::...|              |::...|      .....:::.|.|.||   ..:::||.::.:|.
  Fly   196 FITQIGFCCVYFLFVALNIKDVMDHYY------KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSL 254

  Fly   292 WCTMSHIVINAVILGYCLLQIGD---------WGWSKVRFSIDMENFPISLGVIVFSYTS-QIFL 346
            ...:..:...|:...|.|:.:.|         |.           ..|:..|..::::.. .:.|
  Fly   255 VAALLTVAGLAITFSYMLVDLPDVHTVKPVATWA-----------TLPLYFGTAIYAFEGIGVVL 308

  Fly   347 PTLEGNMIDRSKF---NWMLDWSHIAAAVFKAGFGYICFLTFQNDTQQVITNNLHSQG--FKGMV 406
            | ||.||.....|   ..:|:...:..|......|:..:|.:....:..||.|| .||  ...:|
  Fly   309 P-LENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNL-PQGDTLSQLV 371

  Fly   407 NFFLVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTILMA 471
            ...:.:...|||.|.:|....::| .|.|    :.|.|....|....|    .||.::..|.|:|
  Fly   372 RISMAVAIFLSYTLQFYVPVNIVE-PFVR----SHFDTTRAKDLSATV----LRVVLVTFTFLLA 427

  Fly   472 IFIPHFSILMGFIGSFTGTMLSFIWP------CYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVI 530
            ..||:...::..:|:.:.:.|:.|.|      .::::   |:......:.||.||:..|:...|.
  Fly   428 TCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNV---GYGRFNWMLWKDVLILIFGLCGFVF 489

  Fly   531 GIYDSGNALIN 541
            |.:.|...::|
  Fly   490 GTWASLAQILN 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 90/433 (21%)
SdaC 159..539 CDD:223884 91/424 (21%)
CG13384NP_723383.1 SdaC 92..484 CDD:223884 93/462 (20%)
SLC5-6-like_sbd 94..495 CDD:294310 96/468 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97544987
eggNOG 1 0.900 E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22950
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.