DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and MRPS16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_015312.1 Gene:MRPS16 SGDID:S000005934 Length:121 Species:Saccharomyces cerevisiae

Alignment Length:115 Identity:37/116 (32%)
Similarity:52/116 (45%) Gaps:24/116 (21%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERL----------VALNTERI 74
            ||..|.|..|.|.|:|||...||.:....||.:|::.|:|:...:|.          |.|:.:|.
Yeast     8 IRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRT 72

  Fly    75 RYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWR-------NRRTAAE 117
            :||:|.||..|....:||..||:|       ..||.       ||:...|
Yeast    73 KYWIGVGAQPSETVTKLLRKAGIL-------NDAWATSKNSNVNRKVVFE 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 31/88 (35%)
MRPS16NP_015312.1 S16 6..96 CDD:272848 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0228
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1789
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 1 1.000 T1136183
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 O PTHR12919
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1261
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.