DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and AT5G56940

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_200504.1 Gene:AT5G56940 AraportID:AT5G56940 Length:135 Species:Arabidopsis thaliana

Alignment Length:87 Identity:34/88 (39%)
Similarity:47/88 (53%) Gaps:0/88 (0%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||..|.||.||||:.::..:.|..:....:|.:|.|:|||.....:.:.|..:||:|||..||..
plant     5 IRLSRFGCKNRPFFRVMAADSRSPRDGKHLEVLGYFNPLPGQDGGKRMGLKFDRIKYWLSVGAQP 69

  Fly    85 STPAAELLGIAGLLPIHPRTYM 106
            |.|...||..:||||..|...|
plant    70 SDPVQRLLFRSGLLPPPPMVAM 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 30/78 (38%)
AT5G56940NP_200504.1 rpsP 2..135 CDD:172989 34/88 (39%)
S16 3..83 CDD:272848 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2407
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoInspector 1 1.000 T124598
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 O PTHR12919
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.