DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and AT5G56940

DIOPT Version :10

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_200504.1 Gene:AT5G56940 / 835796 AraportID:AT5G56940 Length:135 Species:Arabidopsis thaliana


Alignment Length:87 Identity:34/87 - (39%)
Similarity:47/87 - (54%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||..|.||.||||:.::..:.|..:....:|.:|.|:|||.....:.:.|..:||:|||..||..
plant     5 IRLSRFGCKNRPFFRVMAADSRSPRDGKHLEVLGYFNPLPGQDGGKRMGLKFDRIKYWLSVGAQP 69

  Fly    85 STPAAELLGIAGLLPIHPRTYM 106
            |.|...||..:||||..|...|
plant    70 SDPVQRLLFRSGLLPPPPMVAM 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 24..85 CDD:459981 22/60 (37%)
AT5G56940NP_200504.1 S16 3..83 CDD:272848 29/77 (38%)

Return to query results.
Submit another query.