DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and SSR16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_195188.1 Gene:SSR16 AraportID:AT4G34620 Length:113 Species:Arabidopsis thaliana

Alignment Length:107 Identity:37/108 (34%)
Similarity:56/108 (52%) Gaps:1/108 (1%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||..||||.:||||.:||.:.:..:....||.:|.:|||....:...|:|..:||:|||..||..
plant     5 IRLARLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIKYWLSVGAQP 69

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEKAE 126
            :.....:|..|||:|..|...:.: :|.:.:.....||...|
plant    70 TDTVESMLFRAGLIPPKPMVVVGS-KNGQKSTSQHVSPITGE 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 31/78 (40%)
SSR16NP_195188.1 S16 3..83 CDD:272848 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2407
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoInspector 1 1.000 T124598
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 O PTHR12919
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.