DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and Mrps16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001102988.1 Gene:Mrps16 RGDID:1582995 Length:135 Species:Rattus norvegicus

Alignment Length:117 Identity:52/118 (44%)
Similarity:73/118 (62%) Gaps:8/118 (7%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||....||||||||.||....:..:....:||:||:|||||.:.|:|||||.:|||:|:|.||.|
  Rat    19 IRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAQL 83

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAA--------EAEASPEKAEST 128
            |.|..:|||::|..|:||.....|.|.||..|        :|::.|::.|::
  Rat    84 SKPMEKLLGLSGFFPLHPMMITNAERLRRKRAREVFLASQKADSEPQETEAS 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 41/78 (53%)
Mrps16NP_001102988.1 S16 17..97 CDD:272848 41/78 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141292627
eggNOG 1 0.900 E1_COG0228
Hieranoid 1 1.000
Homologene 1 1.000 H9370
Inparanoid 1 1.050 105 1.000 Inparanoid score I4772
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 1 1.000 T1087288
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 LDO PTHR12919
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.