DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and Mrps16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_079716.1 Gene:Mrps16 MGIID:1913492 Length:135 Species:Mus musculus

Alignment Length:111 Identity:56/112 (50%)
Similarity:72/112 (64%) Gaps:1/112 (1%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||....||||||||.||....:..:....:||:||:|||||.:.|:|||||.:|||:|:|.||||
Mouse    19 IRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHL 83

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWR-NRRTAAEAEASPEKAESTA 129
            |.|..:|||::|..|:||.....|.| .||.|.|...:.:||||.|
Mouse    84 SKPMEKLLGLSGFFPLHPMMITNAERLRRRRAREVLLASQKAESEA 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 42/78 (54%)
Mrps16NP_079716.1 S16 17..97 CDD:272848 42/78 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141293634
eggNOG 1 0.900 E1_COG0228
Hieranoid 1 1.000
Homologene 1 1.000 H9370
Inparanoid 1 1.050 111 1.000 Inparanoid score I4821
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 1 1.000 T1083735
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 LDO PTHR12919
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1261
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.