DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and MRPS16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_057149.1 Gene:MRPS16 HGNCID:14048 Length:137 Species:Homo sapiens

Alignment Length:119 Identity:56/120 (47%)
Similarity:72/120 (60%) Gaps:10/120 (8%)


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||....||||||||.||....:..:....:||:||:|||||.:.|:|||||.:|||:|:|.||||
Human    19 IRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHL 83

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAA----------EAEASPEKAEST 128
            |.|..:|||:||..|:||.....|.|.||..|          :|||:..:|..|
Human    84 SKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 43/78 (55%)
MRPS16NP_057149.1 S16 17..97 CDD:272848 43/78 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141285443
eggNOG 1 0.900 E1_COG0228
Hieranoid 1 1.000
Homologene 1 1.000 H9370
Inparanoid 1 1.050 108 1.000 Inparanoid score I4842
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 1 1.000 T1073650
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 LDO PTHR12919
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1261
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.