DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and mrps16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001006030.1 Gene:mrps16 ZFINID:ZDB-GENE-041010-123 Length:129 Species:Danio rerio

Alignment Length:108 Identity:50/109 (46%)
Similarity:69/109 (63%) Gaps:0/109 (0%)


  Fly    19 IIRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAH 83
            :||....|.||||||.||....::.:....:|||||:|||||.:||:|||.|.|||::|:..|||
Zfish    18 VIRLALGGATNRPFYRIVAAYNKRARDGKYLEQVGSYDPLPNIHNEKLVAFNYERIKHWIACGAH 82

  Fly    84 LSTPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEKAE 126
            .:.|.|:|||:||..|:||.|...|.|.::.|:..|...:..|
Zfish    83 TTKPVAKLLGLAGFFPLHPMTITEAERRQKAASREEVKTDSQE 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 41/78 (53%)
mrps16NP_001006030.1 S16 17..97 CDD:272848 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141286369
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9370
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12919
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.