DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS16 and mrps-16

Sequence 1:NP_523737.1 Gene:mRpS16 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001022207.1 Gene:mrps-16 WormBaseID:WBGene00018961 Length:147 Species:Caenorhabditis elegans

Alignment Length:133 Identity:58/134 (43%)
Similarity:83/134 (62%) Gaps:14/134 (10%)


  Fly     9 IGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERR---KNQHQPVIEQVGSFDPLPNDYNERLVALN 70
            |.::|.:.:  |.....|||||||||:.|...|   :.....::||||:||||||..||:|||||
 Worm     6 IPKYYGRPS--IGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQKNEKLVALN 68

  Fly    71 TERIRYWLG-KGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNR--------RTAAEAEASPEKAE 126
            ..|::||:| :.||:|.|..||||::||.||||::::.|..||        :.||||..:.:.|:
 Worm    69 FGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLKVAAEAAEAEKVAQ 133

  Fly   127 STA 129
            ..|
 Worm   134 EQA 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 43/82 (52%)
mrps-16NP_001022207.1 Ribosomal_S16 15..97 CDD:294262 43/82 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140844687
eggNOG 1 0.900 E1_COG0228
Hieranoid 1 1.000
Homologene 1 1.000 H9370
Inparanoid 1 1.050 110 1.000 Inparanoid score I3417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1630052at2759
OrthoFinder 1 1.000 FOG0003973
OrthoInspector 1 1.000 T476485
orthoMCL 1 0.900 OOG5_127603
Panther 1 1.100 LDO PTHR12919
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1261
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.