DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Slc25a27

DIOPT Version :8

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus

Alignment Length:286 Identity:95/287 (33%)
Similarity:150/287 (52%) Gaps:16/287 (6%)


  Fly     3 TSDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGE--LAARGSHAQ---PYKSVFQAFVTVAKNDGI 62
            ||.|:|.|.||..|.:.|.|:::.|||:|:|||  ||..|..|.   ||:.:.:..:.:.:.:|.
  Rat    19 TSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGMMRTALGIVQEEGF 83

  Fly    63 LGLQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFF 127
            |.|.:|:.||:....|.:..|:..|.|..|..:..:........|.:..|.:.||:|.:.|:|..
  Rat    84 LKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTD 148

  Fly   128 LIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQ 192
            |:|.|:|.:..:::. |...:...:..|..||..:.|:.|||.|.:.|:.||.:.:...:..:..
  Rat   149 LVKVQMQMEGKRRLE-GKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDT 212

  Fly   193 AKSLL-----KENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGW 252
            .|..|     .|:.:.|| .:.|.||||.|    |:..||.||:.:|:.||..|.||||:.|:..
  Rat   213 VKHYLVLNTALEDNIATH-GLSSLCSGLVA----SILGTPADVIKSRIMNQPRDKQGRGLLYKSS 272

  Fly   253 LDCVLTILRSEGVYGLYKGFWPIYLR 278
            .|||:..::.||...|||||.|.:||
  Rat   273 TDCVIQAVQGEGFLSLYKGFLPSWLR 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/88 (34%)
PTZ00169 5..293 CDD:240302 93/285 (33%)
Mito_carr 101..201 CDD:278578 26/105 (25%)
Mito_carr 204..296 CDD:278578 35/76 (46%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 33/99 (33%)
Mito_carr 122..218 CDD:278578 25/97 (26%)
Mito_carr 224..311 CDD:278578 36/81 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.