DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and DIC1

DIOPT Version :8

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae

Alignment Length:296 Identity:72/297 (24%)
Similarity:135/297 (45%) Gaps:40/297 (13%)


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPAL 73
            ||.|.:.|.:.|:|:::.|.|:|         :...|..::|:...::..|:|::||..||:.|:
Yeast    20 GGAAGIFATMVTHPLDLAKVRLQ---------AAPMPKPTLFRMLESILANEGVVGLYSGLSAAV 75

  Fly    74 CFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAK--GMFWGALGGVVGSYCASPFFLIKTQLQAQ 136
            ..|....:.|...|....|..........:::..  .||.||:||:.|::..    ::..::|..
Yeast    76 LRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFAD----VVNIRMQND 136

  Fly   137 AAKQIAVGYQHQHASMSDAIRKIYR-KNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLL--- 197
            :|.:.|....:::|  .|.:.|||| :.|:..|:.|...|:.|..:.:|.|:..:...|:.|   
Yeast   137 SALEAAKRRNYKNA--IDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTK 199

  Fly   198 -----KENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVL 257
                 .:|  .||.|     :.|.||...:...:|.||:.||:.|...|.|..       |..:.
Yeast   200 LDFDASKN--YTHLT-----ASLLAGLVATTVCSPADVMKTRIMNGSGDHQPA-------LKILA 250

  Fly   258 TILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            ..:|.||...:::|:.|.:.|..|::.|:....::|
Yeast   251 DAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 20/78 (26%)
PTZ00169 5..293 CDD:240302 71/295 (24%)
Mito_carr 101..201 CDD:278578 26/111 (23%)
Mito_carr 204..296 CDD:278578 24/91 (26%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:278578 21/83 (25%)
Mito_carr 100..200 CDD:278578 25/106 (24%)
Mito_carr 203..289 CDD:278578 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.