DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18327 and CG18324

Sequence 1:NP_001260966.1 Gene:CG18327 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster

Alignment Length:300 Identity:176/300 (59%)
Similarity:241/300 (80%) Gaps:0/300 (0%)


  Fly     1 MATSDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGL 65
            |..|||||||.|||||.|||||::|:|||:||||||||||::.:||:.:.||.:.:..|||:|.|
  Fly     1 MTKSDFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLAL 65

  Fly    66 QKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIK 130
            :||||||||:|||:||.|||:|::|:|.|::.|..|.|||.:|||:|||||..|:|.||||::||
  Fly    66 EKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIK 130

  Fly   131 TQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKS 195
            .|..|||.:.||||:||:|.||.||:..|||.||:.|.||.:|.:::|..|||:|||..|.:|||
  Fly   131 AQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKS 195

  Fly   196 LLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTIL 260
            |||:.|.:|||.:||||:||::|:.|::|.:|.||:|||:|||.||.:|||:.|:|.:||...|.
  Fly   196 LLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIW 260

  Fly   261 RSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKY 300
            |:||::|:||||||||.||||::||..:||::|:.||::|
  Fly   261 RTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRY 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 56/83 (67%)
PTZ00169 5..293 CDD:240302 170/288 (59%)
Mito_carr 101..201 CDD:278578 58/100 (58%)
Mito_carr 204..296 CDD:278578 52/92 (57%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 56/83 (67%)
PTZ00169 5..293 CDD:240302 170/288 (59%)
Mito_carr 101..201 CDD:278578 58/100 (58%)
Mito_carr 204..296 CDD:278578 52/92 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235384550
eggNOG 1 0.900 E1_KOG0755
Homologene 1 1.000 H68806
Inparanoid 1 1.050 295 1.000 Inparanoid score I2686
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1013743at2759
OrthoFinder 1 1.000 FOG0001847
orthoMCL 1 0.900 OOG5_129221
Panther 1 1.100 P PTHR45928
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.