DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18327 and SLC25A30

Sequence 1:NP_001260966.1 Gene:CG18327 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 HGNCID:27371 Length:293 Species:Homo sapiens

Alignment Length:259 Identity:79/260 (30%)
Similarity:130/260 (50%) Gaps:12/260 (5%)


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            ||.||:|::.|...|.|:::.|||:|:||:..........|:.:..|.|.:.:.:|:..|..|:|
Human     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIA 73

  Fly    71 PALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQA 135
            ||:..|....:.::..| .::::.::...:.| :....:..|.|.||:.|..|:|..::|.::||
Human    74 PAMLRQASYGTIKIGTY-QSLKRLFIERPEDE-TLPINVICGILSGVISSTIANPTDVLKIRMQA 136

  Fly   136 QAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKEN 200
            | :..|..|       |......||::.|..|||:|......||.:...|::.|:...|..|..:
Human   137 Q-SNTIQGG-------MIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   201 GVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCV--LTILRS 262
            |::.......|.|....|...:||..|:|||.||:.||.|...||...|.|.|||:  ||:|.|
Human   194 GLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQLTVLES 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/81 (30%)
PTZ00169 5..293 CDD:240302 79/260 (30%)
Mito_carr 101..201 CDD:278578 28/100 (28%)
Mito_carr 204..296 CDD:278578 25/62 (40%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 25/92 (27%)
Mito_carr 102..191 CDD:278578 28/98 (29%)
Mito_carr 199..>252 CDD:278578 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.