DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and CG10970

DIOPT Version :10

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_572517.1 Gene:CG10970 / 31830 FlyBaseID:FBgn0030078 Length:103 Species:Drosophila melanogaster


Alignment Length:99 Identity:26/99 - (26%)
Similarity:41/99 - (41%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQIFSCGFELFGRVQGVCLRKQTRDLATMNQ-----VRGWVMNTDEGTVKGQLEGTLPKVNVLKF 65
            |:|..|.||:.|||.     |...:|..:.|     :||::....|...||:|||....::..|.
  Fly     6 EEILCCDFEVRGRVP-----KDAFELFALVQANALGLRGFIAQVSEEKFKGRLEGEGKVIDAFKK 65

  Fly    66 WLLNIGSPRSIIERAEFTPTKEITSHNFSRFSIR 99
            .:|........|:.......|.|..:.:..|.|:
  Fly    66 LILAAADYVQAIKEFIIKNLKVIQEYTYKTFEIK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 13..98 CDD:425830 22/89 (25%)
CG10970NP_572517.1 Acylphosphatase 11..98 CDD:444972 23/91 (25%)

Return to query results.
Submit another query.