DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO1 and C04F12.1

Sequence 1:NP_001246314.1 Gene:AGO1 FlyBaseID:FBgn0262739 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_492573.1 Gene:C04F12.1 WormBaseID:WBGene00007297 Length:944 Species:Caenorhabditis elegans

Alignment Length:1011 Identity:223/1012 (22%)
Similarity:366/1012 (36%) Gaps:271/1012 (27%)


  Fly    82 PSAQN--VAAGGATVAGAAATAAQVA--------------SALGATTGSVTP-AIATATPATQPD 129
            ||.:|  .||...:...:|:.:.|||              |.:..::...|| ||....|...|.
 Worm     2 PSKKNKKAAAAERSATLSASASQQVAKDEQSAPVVPTPELSRVSVSSNPPTPSAIEKPVPLPVPS 66

  Fly   130 MPVFTC--PRRPNLGREGRPIVLRANHFQVTMPRGYVHHYDINIQPDKCPRKVNREIIETMVHAY 192
            .|:|..  |.:.....:.:|:.:..|.:::.:....|..||::                      
 Worm    67 KPLFEYEPPAQLEALAKNKPVKVTTNSYELELKPTPVFRYDVS---------------------- 109

  Fly   193 SKIFGVLKPVFDGRNNLYTRDPLPI----GNER---------LELEVTLPGEGKDRIF------- 237
                 |||...|.     ||||:.:    |.:|         :::.:||.|.|...||       
 Worm   110 -----VLKSFDDS-----TRDPIELAGSKGGDRQRQADLTEIVKVALTLEGLGNLNIFYDGAAML 164

  Fly   238 ----RVTIKWQAQVSLF------------NLEEALEGR------------TRQIPYDAILALDVV 274
                :...|.:.|.::|            :|:|:..||            ::|...:.|   |::
 Worm   165 FTTQKFETKTEKQQAIFMPIPSDHPKLSTSLKESQFGRASGKFHVSIELNSKQSELNTI---DLL 226

  Fly   275 MRHL-----PSMTYTPVGRSFFSSPEGYYHPLGGGREVW-----------------FGFHQSVRP 317
            ...|     |......:..|..:...|:. .|.||.|::                 .|...|::.
 Worm   227 NERLDSAACPVTQMAQIALSAEAKQNGFI-ILDGGHELFDQKNTRRTIGKDGVEDMDGVAASIKM 290

  Fly   318 SQWKMM-----LNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIE 377
            :|....     |.:|.....|:|..|:.|.      |:.||..          :....:|||::.
 Worm   291 AQGNKKTGSAHLVMDYKKKQFFKTGPLKDL------IKGINPN----------QLRSYLKGLRVH 339

  Fly   378 ITHCGQMRRKYRVCNVTRRPAQMQSFP---LQLENGQTV--ECT----VAKYFLDKYRMKLRYPH 433
            .|:..|......:.||          |   ::|.:|..:  :|.    ..|.|.|..:       
 Worm   340 TTYSHQSIFIDGISNV----------PIGEIKLPDGTPLLDDCARVSGKPKSFFDASK------- 387

  Fly   434 LPCLQVGQEHKH-----TY-LPLEVCNIVAGQRCIKKLTDM--QTSTMIKATARSAPDREREINN 490
             |.:||.|.:|.     .| .|:|...:...|    |||..  :....||...|.  |..|::..
 Worm   388 -PAVQVNQYNKREGRRMVYSFPIENLLVKPNQ----KLTQNHGEPPRSIKPELRF--DLIRKVGE 445

  Fly   491 LVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASP- 554
            ..|....|..  ::..|:.|:...:.|....:|.|.:.|.....|                 || 
 Worm   446 SAKLLSPNQT--LKSIGIAINPEPIVVEAMTVPKPTILYKDGAFT-----------------SPD 491

  Fly   555 --NQGVWDM--RGKQFFTG--VE-IRIWAIACFAPQRTVREDALRNFTQQLQKI----SNDAGMP 608
              |:..||:  |..|...|  || ::|..|......::..:.:.:....:||.|    :.|.|| 
 Worm   492 LLNRTSWDVQARNHQSLKGGFVEPMKINKILILYNSQSYSQASPKEAVVELQSILSKKAKDVGM- 555

  Fly   609 IIGQPCFCKYATGPD---------------QVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEVKR 658
            .||| ...:....||               ||:|:..|...|..|....:              :
 Worm   556 TIGQ-IDVEDLNDPDIIGAIENKMTILKTSQVKPIVIYADHTSEGTHSTL--------------K 605

  Fly   659 VGDTVLGMATQCVQAKNVNKTSP--QTLSNLCLKINVKLGGIN-SILVPSIRPKVFNEP--VIFL 718
            :.:.:..:.||.|......|.:|  .|.:||.:|:|:|.||:| .:.|.:....::.:.  .:.:
 Worm   606 LQERLCEVITQQVALDKSLKRTPGKVTANNLLMKLNLKYGGVNHKVRVDNSISHLWGDTSNTLII 670

  Fly   719 GADVTHPPAGDNKKPSIA---AVVG---SMDAHPSRYAATVRVQQHRQEIIQE--LSSMVRELLI 775
            ..||.|......||..|.   :.||   :..|.|..:......|..|.|.:.|  |....|.:|.
 Worm   671 SYDVCHSSGKVYKKDEICDEPSCVGFGFNGTACPEAFIGDFHYQLPRHEQVDEHLLKLRARFMLN 735

  Fly   776 MFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYR---PGITFIVVQKRHH 837
            .:..|...| |.::::.||||||||...|...|..||:::.:.:..|.:   |....:||.|||.
 Worm   736 HYITSRKKY-PQQVVILRDGVSEGQHKMVRNEEFQAIKQSIMNVFNEKKAKAPSFALLVVTKRHA 799

  Fly   838 TRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHF-DS 901
            .||..   |:|:|.: |:|..|.:|..|......:....||..:.||::|...:.|.:|..| .:
 Worm   800 NRLLI---KDQNGYT-NVPPLTAIDQTIVKKQGNEVIFVSHCPLNGTAQPIVINTLVNDGIFKTN 860

  Fly   902 DELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFR 937
            |:|......||..:.:.|..||:|...|.|...|.|
 Worm   861 DQLVQFITALCCAHQKSTNIVSLPESIYAADEYAKR 896

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO1NP_001246314.1 PLN03202 122..935 CDD:215631 207/951 (22%)
ArgoN 138..275 CDD:293095 31/185 (17%)
ArgoL1 286..335 CDD:285861 12/71 (17%)
PAZ_argonaute_like 336..456 CDD:239212 27/135 (20%)
Piwi_ago-like 502..942 CDD:240015 120/481 (25%)
C04F12.1NP_492573.1 ArgoN 85..227 CDD:293095 31/177 (18%)
Piwi 589..902 CDD:214930 87/328 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.