DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shot and CG5984

DIOPT Version :10

Sequence 1:NP_725339.1 Gene:shot / 36542 FlyBaseID:FBgn0013733 Length:8805 Species:Drosophila melanogaster
Sequence 2:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:56/195 - (28%) Gaps:71/195 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  8599 SRSSLSASTPDSLSDNEGSHGGPSGRY--TPRKVTYTS-----------TRTGLT-----PGGS- 8644
            |.:|..:|:...|..|....||..|||  ||....|.|           |..|..     |.|: 
  Fly    16 SSASACSSSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQLLHFPSGAV 80

  Fly  8645 -----------RAGSK---------PNSRPLS--RQGSKPPSRHGSTLSLDSTDDHTPSRIPQRK 8687
                       |.|.|         |:.:|:.  ||....|.|......||              
  Fly    81 RVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQPVRQQQLDPERFQIDCQLD-------------- 131

  Fly  8688 PSTGSTASGTTPRPARLSVTTTTTPGSRL------NGTSTITRKTASGSASPAPTSNGGMSRSSS 8746
                   :|.......:...:.|.|.|..      ..|.:|..|.||.|   .|.|:...||..|
  Fly   132 -------AGAGLYKVHIKCNSVTLPRSPFIIVAIAGATESIDGKPASSS---VPISDSDASRVQS 186

  Fly  8747  8746
              Fly   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shotNP_725339.1 SAC6 204..>420 CDD:227401
CH_PLEC-like_rpt2 223..327 CDD:409038
SPEC 471..689 CDD:238103
SPEC 690..866 CDD:238103
SH3_10 864..929 CDD:407754
SPEC 1047..1250 CDD:238103
SPEC 1153..1390 CDD:238103
PLEC <1498..1526 CDD:197605
Plectin 1949..1980 CDD:459901
DUF5585 2860..>3198 CDD:465521
SMC_prok_B <4936..>5564 CDD:274008
SPEC 5304..5513 CDD:238103
SPEC <5658..5787 CDD:413338
SPEC 5793..6007 CDD:238103
SPEC 6011..6220 CDD:238103
SPEC 6118..6330 CDD:238103
PRK09039 <6279..6441 CDD:181619
SPEC 6443..6660 CDD:238103
SPEC 6663..6878 CDD:238103
SPEC 6880..7087 CDD:238103
SPEC 6986..7196 CDD:238103
SPEC 7196..7417 CDD:238103
SPEC 7314..7526 CDD:238103
SPEC 7528..7747 CDD:238103
SPEC 7749..7968 CDD:238103
SPEC 7973..8181 CDD:238103
FRQ1 <8375..8444 CDD:444056
GAS2 8450..8522 CDD:128539
PHA03307 8550..>8795 CDD:223039 44/195 (23%)
CG5984NP_651548.1 Filamin 65..154 CDD:395505 19/109 (17%)
IG_FLMN 181..271 CDD:214720 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.