DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6337 and Y51A2D.8

Sequence 1:NP_001286395.1 Gene:CG6337 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_507627.1 Gene:Y51A2D.8 WormBaseID:WBGene00013076 Length:386 Species:Caenorhabditis elegans

Alignment Length:331 Identity:81/332 (24%)
Similarity:140/332 (42%) Gaps:47/332 (14%)


  Fly    28 FQTYEDNFNKTY--ASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAA 90
            |:.::..:|:.|  .|.:.:.|.|  |:.:.|.|.:.||::.......:..:|:|||:...:|..
 Worm    43 FEDFKKKYNRKYKDESENQQRFNN--FVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHG 105

  Fly    91 LLPKAV---NT---VTSAASDPPASQAASAS--------------FDI----ITDFGLTVAVEDQ 131
            .|...|   ||   :.:.....|..:||..:              ||:    |....:...::||
 Worm   106 RLSNVVPSNNTGLPMLNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQ 170

  Fly   132 GVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGT-GCSTQTPLAALNYLTQLTD 195
            | .|:..|.:|....||.:.|..:..  ..|||.|::.||...|| ||...:....:.|:.:.. 
 Worm   171 G-QCACCWGFAVTALVETVYAAHSGK--FKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYG- 231

  Fly   196 AYLYPEVDYPNNNSLKTPG-MCQPPSSVSVGVKLAGYSTVADNDDAA---VMRYVSNGFPVIVEY 256
              |..:.|||.:.:....| .|:...:..: |....::....|...|   :::.::.....:..|
 Worm   232 --LSGDEDYPYDQNRANQGRRCRLRETDRI-VPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVY 293

  Fly   257 NPATFGFMQYSSGVYVQ-ETRALTNPKSSQFLVVVGYDHDVDS---NLDYWRCLNSFGDTWGEEG 317
            ......|.:|..||.:: :.|..|...:.   .:||||...||   :.|||...||:|..|.|.|
 Worm   294 FKVGDQFKEYKEGVIIEDDCRRATQWHAG---AIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESG 355

  Fly   318 YIRIVR 323
            |:|:||
 Worm   356 YVRVVR 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 15/62 (24%)
Peptidase_C1A 114..336 CDD:239068 58/238 (24%)
Y51A2D.8NP_507627.1 Inhibitor_I29 43..102 CDD:214853 15/61 (25%)
Peptidase_C1A 148..373 CDD:239068 58/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3950
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.820

Return to query results.
Submit another query.