DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:50/131 - (38%) Gaps:45/131 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 LLPKQQHHHH--------------QQQH----HGLVATVLPAELDSDKGVNGLHFVNSDEDKSLQ 745
            |:|.:||..|              |:||    ||                   |.|..|:..   
  Fly    20 LIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHG-------------------HEVYPDDPH--- 62

  Fly   746 QYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADD-TGFHADVSF 809
               .||.|.|.::|..:|:.....::|| ..|.:|:|.:...||..:.|.|.||. .||:|.|..
  Fly    63 ---PKYNFAYDVQDALSGDSKSQVESRD-GDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHR 123

  Fly   810 E 810
            |
  Fly   124 E 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 16/52 (31%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.