DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Ac

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:50/131 - (38%) Gaps:45/131 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 LLPKQQHHHH--------------QQQH----HGLVATVLPAELDSDKGVNGLHFVNSDEDKSLQ 745
            |:|.:||..|              |:||    ||                   |.|..|:..   
  Fly    20 LIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHG-------------------HEVYPDDPH--- 62

  Fly   746 QYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADD-TGFHADVSF 809
               .||.|.|.::|..:|:.....::|| ..|.:|:|.:...||..:.|.|.||. .||:|.|..
  Fly    63 ---PKYNFAYDVQDALSGDSKSQVESRD-GDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHR 123

  Fly   810 E 810
            |
  Fly   124 E 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 16/52 (31%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.