DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr72Ec

DIOPT Version :8

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster

Alignment Length:313 Identity:65/313 - (20%)
Similarity:111/313 - (35%) Gaps:59/313 - (18%)


  Fly    17 IMTAIISLVQAADTWQRLPSLETFSSY--EDMQRYFDQRNFR--SMRQIDNPTGDTYLAAFNQY- 76
            |:..:::|..||...|| ||    |.|  :|..|.|....:|  :..:.:..:.|.....|..| 
  Fly     8 ILGGLLALTSAAGLPQR-PS----SGYQEQDTARAFYSYGYRDENAARAEYSSRDGTSRGFYSYV 67

  Fly    77 NEQVENQSPRRVAQTHSRIKREQRQLPTAPRMLRFELADAVEPSPELKQI--LRQYHARALKENP 139
            :...:.|:.|..|......|.|....|.||    .:...|..|..:.:::  .|..|..||:|  
  Fly    68 DADGKLQTVRYEANGVQGFKAEASNQPQAP----VDKGKAPLPVTDTEEVQQARLNHLNALRE-- 126

  Fly   140 TAASPASTSQAPTPAVSPTKATKAKSRKPRRQRRSVVGAQQPADFKVQMIPFEETD--AREPDPI 202
                          |.....||..:....|||:..:....:......|.:..|:..  .|....:
  Fly   127 --------------AREKALATSLREEADRRQQEQIRNNNEDQQSGEQSLTDEDAAILERVRAEL 177

  Fly   203 TAQLIKKARSLDLQSQATRSTDFRHTKPQVARKQPIQVRIRKTKRSKRSAPQMIKFELADAKAMP 267
            :|.|..:.|.|:|    .|:.|.|..:.:...:|..:..:|:..|.::...|      .:.:...
  Fly   178 SAMLADRQRELNL----PRNRDDREQREKQEIRQDQRKELRQDLRQEQRQDQ------REDRRQD 232

  Fly   268 QRSGKQMVSEAVPTLLTMETQRNNTQAPQLTTTTPRVEDNDILTGEATAETKR 320
            ||..::            :.||.:.:..|   ...|.||.....||...|.:|
  Fly   233 QREDRR------------QNQREDRRQDQ---REERREDQREERGEDQREERR 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 7/42 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.