DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr72Eb

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:99 Identity:21/99 - (21%)
Similarity:31/99 - (31%) Gaps:42/99 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 HHHQQQHHGLVATVLPAELDSDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQ 770
            :|||.:|                                    .:|.:||      ....:...:
  Fly    36 YHHQDEH------------------------------------GQYAYGY------MAPLYSKHE 58

  Fly   771 NRDLHGVTRGQYHILLPDGRIQNVIYHADDTGFH 804
            .|.:.||.||.:..:..:|..|.|.|.||..|||
  Fly    59 TRTVDGVIRGTFSHIDANGETQTVDYVADAEGFH 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 14/51 (27%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.