DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr23B

DIOPT Version :8

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster

Alignment Length:201 Identity:54/201 - (26%)
Similarity:76/201 - (37%) Gaps:56/201 - (27%)


  Fly   630 PGNNDVKELPAVPSSAASKLPTPSSYIDY----------------THGHGLSNGYEGVTNAE--- 675
            |.||      |:.|.|     ||..| ||                .....|........|||   
  Fly    48 PSNN------ALNSEA-----TPDGY-DYVAPARNQFTAGSRTASVQASNLLQNAASAANAESVL 100

  Fly   676 --EPVTTVEHVVHHPTVATQLHHQVLLPKQQHHHHQQQHHGLVATVLPAELDSDKGVNGLHFVNS 738
              .|:..:.|..:...|::....|    :||...|||....:|::||                ..
  Fly   101 LPSPLPVLRHEQNSEVVSSTQQQQ----EQQTVQHQQSEPLVVSSVL----------------RQ 145

  Fly   739 DEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADDT-G 802
            .::..:...|| |.|.|.:.|..||:...|.:.||.: |.||.|.::.|||..:.|.|.|||. |
  Fly   146 HQEPEVFPPAS-YSFNYAVNDASTGDIKEHSETRDGY-VVRGFYSLIDPDGYKRTVTYTADDVHG 208

  Fly   803 FHADVS 808
            |:|.|:
  Fly   209 FNAVVN 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 21/52 (40%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.