DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr30F

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:58 Identity:21/58 - (36%)
Similarity:33/58 - (56%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 YEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADV 807
            |:|.|.:.|.|||:.....::|....| :|||.::..||.::.|.|.:| ..||:|.|
  Fly    45 YDFAYSVHDEHTGDIKSQTESRKGDQV-QGQYTLVDADGYLRTVDYTSDAHNGFNAVV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 17/52 (33%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.