powered by:
Protein Alignment Cpr50Ca and Cpr30F
DIOPT Version :8
Sequence 1: | NP_610899.1 |
Gene: | Cpr50Ca / 36523 |
FlyBaseID: | FBgn0033867 |
Length: | 815 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723504.1 |
Gene: | Cpr30F / 318997 |
FlyBaseID: | FBgn0051876 |
Length: | 146 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
Similarity: | 33/58 - (56%) |
Gaps: | 2/58 - (3%) |
Fly 751 YEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADV 807
|:|.|.:.|.|||:.....::|....| :|||.::..||.::.|.|.:| ..||:|.|
Fly 45 YDFAYSVHDEHTGDIKSQTESRKGDQV-QGQYTLVDADGYLRTVDYTSDAHNGFNAVV 101
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR12236 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.