powered by:
Protein Alignment Cpr50Ca and Cpr30F
DIOPT Version :9
| Sequence 1: | NP_610899.1 |
Gene: | Cpr50Ca / 36523 |
FlyBaseID: | FBgn0033867 |
Length: | 815 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_723504.1 |
Gene: | Cpr30F / 318997 |
FlyBaseID: | FBgn0051876 |
Length: | 146 |
Species: | Drosophila melanogaster |
| Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
| Similarity: | 33/58 - (56%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 751 YEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADV 807
|:|.|.:.|.|||:.....::|....| :|||.::..||.::.|.|.:| ..||:|.|
Fly 45 YDFAYSVHDEHTGDIKSQTESRKGDQV-QGQYTLVDADGYLRTVDYTSDAHNGFNAVV 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.