DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PDX1 and zen2

Sequence 1:NP_000200.1 Gene:PDX1 HGNCID:6107 Length:283 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:161 Identity:56/162 (35%)
Similarity:83/162 (51%) Gaps:38/162 (23%)


Human   144 EENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK 208
            |::||:|||::..||:|||:||..|||::|.||:|::..|.||||.:||||||||||.||..::|
  Fly    41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105

Human   209 RGGGTAVGGGGVAEP---------EQDCAVTSGEELLALPPPPPPGGAVPPAAPV------AARE 258
                .|:|....:.|         ::|..:.  |.||..      .......||:      ...|
  Fly   106 ----GAIGALTTSIPLSSQSSEDLQKDDQIV--ERLLRY------ANTNVETAPLRQVDHGVLEE 158

Human   259 GRLPPGLSA-------SPQPSSVAPRRPQEP 282
            |::.|...:       ||:|.::    ||.|
  Fly   159 GQITPPYQSYDYLHEFSPEPMAL----PQLP 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PDX1NP_000200.1 Transactivation domain. {ECO:0000250} 13..73
Antp-type hexapeptide 118..123
Homeobox 149..202 CDD:278475 32/53 (60%)
Nuclear localization signal. {ECO:0000250} 197..203 5/6 (83%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 32/53 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45664
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.