DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cid and Hist1h3g

Sequence 1:NP_523730.2 Gene:cid FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_659539.1 Gene:Hist1h3g MGIID:2145541 Length:136 Species:Mus musculus

Alignment Length:148 Identity:49/149 (33%)
Similarity:68/149 (46%) Gaps:29/149 (19%)


  Fly    91 RSPQTRRMTV-----QQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQ 141
            |:.||.|.:.     :::..|:||           ||:|......|:..         |||||.|
Mouse     3 RTKQTARKSTGGKAPRKQLATKAA-----------RKSAPATGGVKKPHRYRPGTVALREIRRYQ 56

  Fly   142 HHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVT 206
            .....||.||||.|||||....:..|  ||....|::|:||:||.||.....|:.:...|..|||
Mouse    57 KSTELLIRKLPFQRLVREIAQDFKTD--LRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVT 119

  Fly   207 LEVRDMALMAYICDRGRQ 224
            :..:|:.|...|  ||.:
Mouse   120 IMPKDIQLARRI--RGER 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 Histone 90..219 CDD:278551 47/142 (33%)
H4 135..219 CDD:304892 36/84 (43%)
Hist1h3gNP_659539.1 PTZ00018 1..136 CDD:185400 49/149 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.