DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and his-6

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_505199.1 Gene:his-6 / 191668 WormBaseID:WBGene00001880 Length:136 Species:Caenorhabditis elegans


Alignment Length:177 Identity:49/177 - (27%)
Similarity:67/177 - (37%) Gaps:51/177 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRSSTLRRDAGRRQP-------AARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPV 112
            |...|.|:..|.:.|       |||.|:.:.....:.:||                    ..|.|
 Worm     3 RTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRY--------------------RPGTV 47

  Fly   113 AAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGAL 177
            |.                    |||||.|.....||.:.||.|||||....:..|  ||....|:
 Worm    48 AL--------------------REIRRYQKSTELLIRRAPFQRLVREIAQDFKTD--LRFQSSAV 90

  Fly   178 LAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQ 224
            :|:||:.|.||.....|:.:...|..|||:..:|:.|...|  ||.:
 Worm    91 MALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI--RGER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 32/83 (39%)
his-6NP_505199.1 PTZ00018 1..136 CDD:185400 49/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.