DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cid and his-69

Sequence 1:NP_523730.2 Gene:cid FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_497811.1 Gene:his-69 WormBaseID:WBGene00001943 Length:127 Species:Caenorhabditis elegans

Alignment Length:137 Identity:43/138 (31%)
Similarity:59/138 (43%) Gaps:13/138 (9%)


  Fly    88 PTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLP 152
            |..::|:.:..|..........|.|...::.|....|.         |||||.|.....|:.|||
 Worm     3 PGGKAPRKQLATKAARKNAIVVGAVKKPHRFRPGTVAL---------REIRRYQKSTDLLLRKLP 58

  Fly   153 FSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAY 217
            |.|||||.......|  ||....|:.|:||:.|.:|.....|:.:...|..|||:..:||.|...
 Worm    59 FQRLVREIAQDVKQD--LRFQSAAIQALQEASEYFLVGLFEDTNLCAIHAKRVTIMPKDMQLARR 121

  Fly   218 ICDRGRQ 224
            |  ||.:
 Worm   122 I--RGER 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 Histone 90..219 CDD:278551 40/129 (31%)
H4 135..219 CDD:304892 34/84 (40%)
his-69NP_497811.1 Histone 1..123 CDD:278551 41/133 (31%)
PTZ00018 4..126 CDD:185400 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.704428 Normalized mean entropy S10
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.