DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17047 and CG13313

Sequence 1:NP_001286385.1 Gene:CG17047 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648267.1 Gene:CG13313 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster

Alignment Length:379 Identity:95/380 (25%)
Similarity:147/380 (39%) Gaps:93/380 (24%)


  Fly    49 DSCVTNSGTTGTCLTRFKCMRQSGTVNGYCGT---YGVCCETNLQVGSSTRQKRTIIKNPGVLSS 110
            |.||.|:...|||:...:|...||...|.|.:   ..:||......|:||....|...|      
  Fly    84 DICVGNNLLLGTCVINGECTDNSGVAAGSCSSITAQAICCIYQRTCGASTSYNNTYFYN------ 142

  Fly   111 DLNTY------------TIEAFSSNVQQLRIDFEQFVMQQPTDVDGVLECQDYFEAGGF----KL 159
              :.|            .:....|::.|||:||....:..|:. ||..........||.    .:
  Fly   143 --SNYPAPYGGGGRCSIVVTPPDSSICQLRVDFLSLSLAPPSG-DGSCSTDALTITGGASQVPSI 204

  Fly   160 CGVNDGQHLYLPFNAAAGVDQVTLTFVVTSRGTAPV---WRLIVTQLEGPPANSRRRSSTSTGLG 221
            ||.|.|||:|:.||   ||..:|::  |.:.|:...   |:..:..|               |..
  Fly   205 CGENAGQHVYVDFN---GVSPITIS--VATSGSYTFNRNWQFQIRML---------------GCT 249

  Fly   222 TSTNSLQDLRDIFASHHADYELLAPPGCQQYYTDLSGTIRSFNFQTSVTS----------NYMPD 276
            ::|                   |||.||.|||...|||:.|||:.::..|          ..:.:
  Fly   250 SAT-------------------LAPAGCLQYYMPSSGTLASFNYNSAAASALNSIGVQGTRQLAN 295

  Fly   277 LSYNICIRSATSASMIEYS---FSKFSMSVQSDSGEGYDEFCHATVHTTGRQ--EDYLMIPQSIL 336
            ..|.||||.|.....|.||   ...:|.::.:|.| ..|....||.....::  .||::|| |..
  Fly   296 TKYGICIRKAAGMCSITYSQVGSDTYSFTLTNDVG-AVDPTLLATSSVQSQECTTDYIIIP-SPT 358

  Fly   337 AKNMAYQPTYYCGTNDNLLVYASPPYMMHFSSDDLTLNRDVE---TGFSMTYRQ 387
            ...:|.....:||........::.|::::..:|.   |.|::   .||.::|.|
  Fly   359 QGGVAMPSDRFCGLGLVSTTTSAKPFVVYTVTDG---NEDMDISNRGFYLSYSQ 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17047NP_001286385.1 None
CG13313NP_648267.1 CUB 129..>214 CDD:294042 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.