DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17047 and CG4734

Sequence 1:NP_001286385.1 Gene:CG17047 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610864.1 Gene:CG4734 FlyBaseID:FBgn0033826 Length:325 Species:Drosophila melanogaster

Alignment Length:314 Identity:108/315 (34%)
Similarity:148/315 (47%) Gaps:40/315 (13%)


  Fly    92 GSSTRQKRTIIKNPGVLSSDLNTYTIEAFSSNVQQLRIDFEQFVMQQP---TDVDGV--LEC-QD 150
            |.:|..|...:.|| .....:..|.|:|.|..|.|||||: ...:.||   ||..|:  .|| :|
  Fly    29 GGTTSSKNINLVNP-TNPPRVCEYHIKATSKYVCQLRIDW-AMTLAQPTLETDDSGLTYAECTRD 91

  Fly   151 YFEAGGFKLCGVNDGQHLYLPFNAAAGVDQVTLTFVVTSRGTA-----PVWRLIVTQLEGPPANS 210
            |||..|.||||....||:|:||||..|...|.|...:..|..|     ..|.:.|||||.|    
  Fly    92 YFEVDGLKLCGTEVWQHIYVPFNATDGESLVDLVISLADRAGASGLPTAYWDMTVTQLECP---- 152

  Fly   211 RRRSSTSTGLGTSTNSLQDLRDIF-----ASHHADYELLAPPGCQQYYTDLSGTIRSFNFQTSVT 270
                     .|.|..|| ||.|..     ||...|...:|||||:||:.:..|.::|||:... .
  Fly   153 ---------AGASVRSL-DLEDDVTIESRASTIKDGFFVAPPGCRQYFPEAKGAVKSFNYNDG-D 206

  Fly   271 SNYMPDLSYNICIRSATSASMIEYSFSKFSM-SVQSDSGEGYDEFCHATVHTTGRQEDYLMIPQS 334
            ..|...::|.||.|..|....:......|:: .|.|.|....||.|:::..|.....|:||:||:
  Fly   207 GIYPSRMNYAICFRRQTDTKTLTIRAYDFNVGDVVSASTLMTDENCYSSDSTNDLDADFLMVPQA 271

  Fly   335 ILAKNMAYQPTYYCGTNDNLLVYAS---PPYMMHFSSDDLTLNRDVETGFSMTY 385
            .. ::.....||:||:....:|.:|   .|.|:.|:|||  :.|..|.||:.||
  Fly   272 TF-EDTHKHATYFCGSIKKDVVISSNNPGPLMVLFNSDD--IYRQNEAGFAFTY 322



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2D4IW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33236
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.