DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17047 and CG15153

Sequence 1:NP_001286385.1 Gene:CG17047 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_609863.1 Gene:CG15153 FlyBaseID:FBgn0032663 Length:364 Species:Drosophila melanogaster

Alignment Length:348 Identity:121/349 (35%)
Similarity:173/349 (50%) Gaps:55/349 (16%)


  Fly    83 VCCETNLQVGSSTRQKRTIIKNPGVLS-SDLNT--YTIEAFSSNVQQLRIDFEQFVMQQP--TDV 142
            |.|  |.:.| ..||||.::.:||... ::|:|  |.:..:|..|.|:|:|||:..:.||  ...
  Fly    23 VAC--NARSG-PVRQKRIVLSSPGTGGLAELDTCQYRVAPWSGQVCQVRVDFERLELPQPQLNAN 84

  Fly   143 DGVLECQDYFEAGGFKLCGVNDGQHLYLPFNAAAGVDQVTLTF-VVTSRGTAPVWRLIVTQLEGP 206
            .|||||.|:.:...|:|||.|.|||||:|....   .::.|.| :.||.|....|:|.:||||.|
  Fly    85 SGVLECVDFLQIQHFRLCGRNSGQHLYIPIRRG---QELQLLFRLATSLGRQSTWQLTLTQLECP 146

  Fly   207 PANSR----RRSSTST-----------------------GLGTSTNSLQDLRDIFAS-HHADYEL 243
            ..::|    |:....|                       |:|:.:.....|...|.| ..||.|:
  Fly   147 RDSARGVGTRQPEVQTPTVRPILPFLGNFLPRTIFGGQSGIGSGSGPAAQLIQTFTSPSSADLEM 211

  Fly   244 LAPPGCQQYYTDLSGTIRSFNFQTSVTSNYMPDLSYNICIRSATSASMIEYSFSKFSMSVQSDS- 307
            |||.||.|||...:|.|.||||...|   |||::.|:||::.|.. :.|.|..:.|.:|..:.. 
  Fly   212 LAPLGCDQYYRTTTGGIVSFNFAGGV---YMPNMKYSICVKGAAD-NEISYKITHFELSKANSEQ 272

  Fly   308 -GEGYDEFCHATVHTTGRQEDYLMIPQSILAKNMAYQPTYYCGTNDNLL----VYASPPYMMHFS 367
             |..||..|.:||.|..|..||:.||.:.:......|.|:|||   |.|    :.|.||:::.|:
  Fly   273 PGPAYDTDCRSTVLTPLRVSDYVSIPDAYMVGRPELQATHYCG---NGLAGQELVARPPFVLRFA 334

  Fly   368 SDDLTLNRDVETGFSMTYRQRNS 390
            ||  :.:...||||.:||..|.|
  Fly   335 SD--SQSSGSETGFQLTYTVRRS 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17047NP_001286385.1 None
CG15153NP_609863.1 CUB 217..352 CDD:294042 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140886533
eggNOG 1 0.900 E1_2D4IW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.