DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE14 and GstE3

Sequence 1:NP_610855.1 Gene:GstE14 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:232 Identity:70/233 (30%)
Similarity:115/233 (49%) Gaps:33/233 (14%)


  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69
            |..||..:.||||||.|:.::.|::|.:.:.|||.:.|..:.:||.:||.|:||.|......|.|
  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67

  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQ----------- 123
            ||||..:|..|:....||:|::..:|..|...|.:        ||..:::|.|.           
  Fly    68 SHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHY--------DSSVVTSTGRAITFPLFWENKT 124

  Fly   124 --GFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPR 184
              ..|.:|.      |...|..:..:|||.:::||..||:||..::..|:...:..|:  :::|.
  Fly   125 EIPQARIDA------LEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPE 183

  Fly   185 LRRWFTAMQQLDAY-EANCSGLEKLRQTMESVGSFQF 220
            |..|...:::|..| |||.|   :..|.:|.:.|.:|
  Fly   184 LAAWIKRIKELPYYEEANGS---RAAQIIEFIKSKKF 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 62/210 (30%)
GST_N_Delta_Epsilon 6..79 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/131 (24%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 60/205 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.