DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE14 and GstE1

Sequence 1:NP_610855.1 Gene:GstE14 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster

Alignment Length:206 Identity:65/207 (31%)
Similarity:106/207 (51%) Gaps:13/207 (6%)


  Fly     1 MSQPKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDL 65
            ||....:||..:.||.||:..:.:|:|::|.|.:.|||..||...::::..||||:||.|.....
  Fly     1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGT 65

  Fly    66 VLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV-- 128
            .:.|||||..:|.:|:.:...|:|::.|:|..|...|.|:.|.::...::........|...|  
  Fly    66 FIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQ 130

  Fly   129 ---DVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRW 188
               |..|...||      :|.:|.||.::||..|||||||...|:|.|.....:  :.:|::..|
  Fly   131 EKLDAVHQGLKL------LETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAW 189

  Fly   189 FTAMQQLDAYE 199
            ...:.:|..|:
  Fly   190 LDRLNKLPYYK 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 63/202 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/73 (38%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/114 (27%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 28/73 (38%)
GstA 8..197 CDD:223698 62/195 (32%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.