DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4679 and AT1G74580

Sequence 1:NP_610854.1 Gene:CG4679 FlyBaseID:FBgn0033816 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001322154.1 Gene:AT1G74580 AraportID:AT1G74580 Length:763 Species:Arabidopsis thaliana

Alignment Length:583 Identity:120/584 (21%)
Similarity:207/584 (35%) Gaps:172/584 (29%)


  Fly   140 LISQGELKDAVLVYNLLEQKGNPISPELKQSLLELVCFHNNQEPIPEEYIEERWFLQNNKRRERS 204
            |..:|||..||.:...|.::|.........:|:..:| .|::....|.|:.:    ..|:..|..
plant   261 LCQRGELDGAVRMVGCLIEQGPKPDVITYNNLIYGLC-KNSKFQEAEVYLGK----MVNEGLEPD 320

  Fly   205 GKTW--------KDG--DLAEKLYSE--IEPKTPQ--SYASLIRGMAKYLQCERAYALLQEAGEK 255
            ..|:        |.|  .|||::..:  .....|.  :|.|||.|:....:..||.||..||..|
plant   321 SYTYNTLIAGYCKGGMVQLAERIVGDAVFNGFVPDQFTYRSLIDGLCHEGETNRALALFNEALGK 385

  Fly   256 QVQLDTNTFNSVIEIVS---FLKDTAEQRWQLCKDLLNEMSQQKLRPNLGTLNAVLQ------CI 311
            .::.:...:|::|:.:|   .:.:.|:        |.||||::.|.|.:.|.|.::.      |:
plant   386 GIKPNVILYNTLIKGLSNQGMILEAAQ--------LANEMSEKGLIPEVQTFNILVNGLCKMGCV 442

  Fly   312 S-------------------TFG------NFKVARAAALQALPEFKQLGVNPSLGSYYYLLIIFC 351
            |                   ||.      :.::....||:.|......||:|.:.:|..||...|
plant   443 SDADGLVKVMISKGYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDVYTYNSLLNGLC 507

  Fly   352 R---------------ERGPVSHVI------------------VDILNDISGKEFQIQHPKDTYF 383
            :               |:|...::.                  :.:|.::..|...    .|...
plant   508 KTSKFEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVN----PDAVT 568

  Fly   384 FATAMD-VCRNHLHD--KSLAKKVDELLHTGKN---YDLVGDSFKESIYYRNYLALLCQTESTED 442
            |.|.:| .|:|...|  .:|.:|::|......:   |:::..:|.|.:                 
plant   569 FGTLIDGFCKNGDLDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKL----------------- 616

  Fly   443 FMLSYDLLVPNIYIPEPGIMEEILRAIEINGAVEYVPRLWSDMVVFDHTHRESLLLYVLRILVDN 507
                      |:.:.|....|.:.|.:..:|   |..||..|  .|..|...:|....|..:::|
plant   617 ----------NVTMAEKLFQEMVDRCLGPDG---YTYRLMVD--GFCKTGNVNLGYKFLLEMMEN 666

  Fly   508 KPNPDSPAQAQLPEQGAKV-ALDMFERVEEAIKRLRKVSFTGQMLGDILTLLVRGGSYEKATEVF 571
            ...|      .|...|..: .|.:.:||.||              ..|:..:|:.|...:|....
plant   667 GFIP------SLTTLGRVINCLCVEDRVYEA--------------AGIIHRMVQKGLVPEAVNTI 711

  Fly   572 AHIDKNQHRIPGTPSLNALIEFVDASVQEKSPSQALFALQYAVENNFDS-RELAKRIHEGFTL 633
            ..:||.:...|         :.|...:.:||     ....||.|..||. |:...|..:|||:
plant   712 CDVDKKEVAAP---------KLVLEDLLKKS-----CITYYAYELLFDGLRDKRLRKKKGFTV 760

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4679NP_610854.1 PLN03218 <210..>348 CDD:215636 43/178 (24%)
PPR repeat 228..255 CDD:276811 11/27 (41%)
PPR repeat 261..295 CDD:276811 9/37 (24%)
AT1G74580NP_001322154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.