DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and SLC22A16

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_149116.2 Gene:SLC22A16 HGNCID:20302 Length:577 Species:Homo sapiens

Alignment Length:591 Identity:176/592 (30%)
Similarity:282/592 (48%) Gaps:79/592 (13%)


  Fly    15 FDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGANWV 79
            |:.|...:|.||||||..|.:.....:....:.|:.||...:|.:.|..|.....|.....:|| 
Human     6 FEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNW- 69

  Fly    80 SIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCF---AENFTT----------E 131
            |:...|:....|.....|.:  :.||:          .|.|.:|.   .||.::          |
Human    70 SLEDTGALLSSGQKDYVTVQ--LQNGE----------IWELSRCSRNKRENTSSLGYEYTGSKKE 122

  Fly   132 TERCNQFVYGSS--ERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFL 194
            ....:.::|..:  :.|.|.||.|.| :..|....:..:...|:::|:...||.:||.||:.:..
Human   123 FPCVDGYIYDQNTWKSTAVTQWNLVC-DRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLW 186

  Fly   195 FCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYA 259
            .....|.|.|:|.|.:.||.:|:......|:..||...:.|:..:|.:|.:.|..:|:.|:.|:|
Human   187 ATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFA 251

  Fly   260 VGEALLGLSVFL-PDWRQLQLALS---VPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAK 320
            ||..|:.|:.:| ..|...|:.||   ||.::|.   |::||:..|||:..|.|:|..|:...||
Human   252 VGTLLVALTGYLVRTWWLYQMILSTVTVPFILCC---WVLPETPFWLLSEGRYEEAQKIVDIMAK 313

  Fly   321 VNRRDISVELMASFKQQELDAETGQEDDVEGGL-----HVKKDDKIWLAVKEVARSHILMGRYAI 380
            .||       .:|.|..||     ...|::|.:     .|:|.:..:|..     :..:..|...
Human   314 WNR-------ASSCKLSEL-----LSLDLQGPVSNSPTEVQKHNLSYLFY-----NWSITKRTLT 361

  Fly   381 LLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCS 445
            :.|||...::.:|..|||:.:|.||:|||..|:.:||||.|:...:.:.:.|||..|:.||...:
Human   362 VWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSA 426

  Fly   446 ITCVASGFV-TLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPT 509
            :.|   |.| .:.|..:|                 |.|...:|||..|.::|.:||.:|||:.||
Human   427 LAC---GVVMVIPQKHYI-----------------LGVVTAMVGKFAIGAAFGLIYLYTAELYPT 471

  Fly   510 VIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTV 574
            ::||..||..|...|..::||||...|:|.:..:|.|..||::|::|:|:|.||||..::|..|.
Human   472 IVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTW 536

  Fly   575 EEAIAL 580
            |||..|
Human   537 EEAAKL 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 169/575 (29%)
MFS 158..533 CDD:119392 118/385 (31%)
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 169/575 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.