DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and GIT1

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae

Alignment Length:249 Identity:52/250 (21%)
Similarity:98/250 (39%) Gaps:62/250 (25%)


  Fly   148 VQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLF----CIVFMALTGVAQA 208
            |.:|.|          .:|.:    .|:|..:..||:||.|||:..:|    .|:|..:.|.|  
Yeast   307 VAEWNL----------LLGVL----AVLGVPIGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCA-- 355

  Fly   209 LSWDYIS------FLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGE----- 262
              :|.:.      .:|:|.:|.:|.:|...:..:|..|       ..::.|...||.:..     
Yeast   356 --YDQLKKITPLFIIFYAFMNMLGNAGPGDMLGVISSE-------ASATAVRGVFYGLSAVTGKI 411

  Fly   263 -ALLGLSVFLP-------DWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRR-- 317
             :::|:..|.|       .|..:..|:.....|.:.||: ||.|:...|.:...|....::..  
Yeast   412 GSVVGVECFQPIRDNLGARWTFIIAAICGLIGIIITYFF-VPHSLESDLMKQDVEFHNYLVSNGW 475

  Fly   318 AAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARS 371
            ..|:...:...|.|.    :.::.|       |.|.:..|.:...::|::|.:|
Yeast   476 TGKMGFDETDEESMV----RTIEVE-------ENGTNCSKKNAEIISVRQVDQS 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 52/250 (21%)
MFS 158..533 CDD:119392 49/240 (20%)
GIT1NP_010022.1 Sugar_tr 46..466 CDD:306568 42/185 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1712
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.