DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and OCT5

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_178059.1 Gene:OCT5 AraportID:AT1G79410 Length:515 Species:Arabidopsis thaliana

Alignment Length:581 Identity:134/582 (23%)
Similarity:228/582 (39%) Gaps:113/582 (19%)


  Fly    10 SAVLDFDDILVE-IGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAE 73
            |:.|.||.||.: :.:||..|....:|:.|.:.|.:......|||...||:.|            
plant    20 SSPLTFDKILEKSLSDFGFSQFLQIVLVGLALTFDSQQIFITVFTDAYPTWHC------------ 72

  Fly    74 YGANWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERCNQF 138
                                    .:..:.|....:....|.|||..|.                
plant    73 ------------------------LDHTICNPATTDICKIPRSAWDWDG---------------- 97

  Fly   139 VYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCIVFMALT 203
              |...::::.::.|:|..:..:.....|.:...:|.|..|:.......|||.:..|....|:||
plant    98 --GFKGKSVISEFDLECSSSFLRSLPSSTFYVGSIVGGVVLAMIPDGSLGRKQLLFFSSFAMSLT 160

  Fly   204 GVAQALS---WDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVG-EAL 264
            |::..||   |.| |||.|.:..|...:|.|.|..|  .|.:..:.|..:::|....:.:| .:|
plant   161 GISIFLSSNIWIY-SFLKFVIGFARSQTGTYALVLI--SERISTKWRPRATMVPFTLFVLGFMSL 222

  Fly   265 LGLSVFL--PDWRQLQLALSVPPLI--CVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRD 325
            .|::..:  ..|:.|.|..|:|..|  ...||:.: ||.|||....:.::|..:::|.:..||  
plant   223 SGIAYLVRHASWKVLYLCTSIPAGIHSIFIYFFAL-ESPRWLHLEGKNKEAIEVLKRISPANR-- 284

  Fly   326 ISVELMASFKQQELDAETGQEDDVEGGLHVKK--DDKIWLAVKEVARSHILMGRYAILLLIWAVN 388
                              |..:.|...|..|:  :.....::|::........|..::::|....
plant   285 ------------------GYLESVSSRLRPKETLEQTSSYSIKDLFIIKWAFRRVTLVMIIMFGL 331

  Fly   389 AIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASG- 452
            .:.|||:.|....:..|.|::.||..:||:|.:.:..:.|.:|.||    .|:|:..:...||| 
plant   332 GMSYYGVPLAVRDIKVNIYMSEALNAMVELPTFVVTPILLEQFSRR----SSVLVNCLIGGASGV 392

  Fly   453 --FVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGG 515
              ||....|     :|.:        |..|.:..|...::|    |.::..:..|:.||.:|:..
plant   393 LCFVMSLYG-----RTKI--------AFALELGSFFCARIG----FNLMAIYLVELFPTCVRNSA 440

  Fly   516 VGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 576
            ..::......|....|.:..|......|...:||......||.:||||||....|.||:||
plant   441 TMMLRQALVVGGACCPLIASLGRNVPSLSFAVFGFAMSGLGLFALLLPETKGLSLCDTMEE 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 125/563 (22%)
MFS 158..533 CDD:119392 90/388 (23%)
OCT5NP_178059.1 Sugar_tr 113..504 CDD:278511 107/435 (25%)
MFS 114..488 CDD:119392 99/419 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D704438at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
33.120

Return to query results.
Submit another query.