DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and OCT3

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_173089.1 Gene:OCT3 AraportID:AT1G16390 Length:518 Species:Arabidopsis thaliana

Alignment Length:563 Identity:142/564 (25%)
Similarity:225/564 (40%) Gaps:98/564 (17%)


  Fly    22 IGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGANWVSIAVPGS 86
            ||:||..|.....|:.....|.|..:...|||...|.:.|  ...|: ||               
plant    33 IGDFGWAQFLQAALVSFAWFFDAQQTFITVFTDSQPMWHC--DNSDR-VD--------------- 79

  Fly    87 WSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERCNQFVYGSSERTIVQQW 151
                     |.|....:|...|.:.:  || |.|               |..|      :|:.:|
plant    80 ---------SVCNTSSSNLCTLPNQT--WS-WDL---------------NPHV------SIISEW 111

  Fly   152 GLQCPENLWKLAFVGTIHFAG-LVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYIS 215
            ||||..:..| .|..:..|.| |:.|.|||.......|||::.|...:.|:|:.:..|.|.....
plant   112 GLQCAGSFLK-GFPASSFFLGCLIGGLALSTLADSSLGRKNMLLLSCLIMSLSSMLTAFSTSIWV 175

  Fly   216 FLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEALLGLSVFLPD---WRQL 277
            :.|...||..|.:.:...|.::..|:||.:.|.....:..:.:.:|...|.:..::.:   ||.|
plant   176 YAFLRFLNGCGRATIGTCALVLSTELVGKKWRGQVGAMGFFCFTLGFLSLPMLGYINEGNSWRNL 240

  Fly   278 QLALSVPPLI-CVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRDISVELMASFKQQELDA 341
            .:..|:|.|| |......|.||.|||:.:.|:|:|..|::..|       |..:..||.....:.
plant   241 YVWTSIPTLIYCCLVRSFVRESPRWLIVKGRKEEAVSILQSIA-------SNAITMSFTNLCFEV 298

  Fly   342 ETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNK 406
            |..|.         |.:..::.|:|.:.|......|....:::.....:||||:.|..|:|:.|.
plant   299 ENDQS---------KSNPDVYDALKILVRKSWSFRRLLAAMVVGFGIGMVYYGMPLALTNLNFNL 354

  Fly   407 YLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVTLAQGDWIPCQTGVESR 471
            ||......|.|.|.:.:.:.|:.:..||.||.|...|..|:  ::....|.|      |.|.   
plant   355 YLGVVFNALSEFPAFLITFFFIDKINRRDALIGFTALSGIS--SALIAVLGQ------QLGS--- 408

  Fly   472 HSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLL 536
                    |.:.|.||......::|.:...:|.||.||.:|:..:.::.....||.:   |.|::
plant   409 --------LQIVLELVSFFSACTAFNMTLIYTIEMFPTCVRNSAISMVRQALVFGGV---FSPVM 462

  Fly   537 ASYYDPLPLLLFGTLSLVAGLLSLL---LPETFNRKLPDTVEE 576
            .:.........:|...|:.||..|.   ||||....|.||::|
plant   463 VAAGRENQFWSYGLFGLIIGLCGLFVFGLPETRGSVLCDTMDE 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 139/558 (25%)
MFS 158..533 CDD:119392 96/380 (25%)
OCT3NP_173089.1 2A0119 25..502 CDD:273328 140/559 (25%)
MFS 126..492 CDD:119392 101/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I994
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.