DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and OCT4

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_188702.2 Gene:OCT4 AraportID:AT3G20660 Length:526 Species:Arabidopsis thaliana

Alignment Length:572 Identity:159/573 (28%)
Similarity:267/573 (47%) Gaps:106/573 (18%)


  Fly    13 LDFDDILVE-IGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGA 76
            |..|::|.. .|||||:|.::::|.|:.....|.:::..:|....|.:||...:|.         
plant    32 LCIDEMLQRYCGEFGRWQLKHFVLTCIAWALEAFHTMVMIFADQEPEWRCVGSDCR--------- 87

  Fly    77 NWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERCNQFVYG 141
                   .||.:         ||        |:.||..|:|..                     |
plant    88 -------VGSLN---------CE--------LDPSSWEWTAGK---------------------G 107

  Fly   142 SSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLAD-RYGRKHIFLFCIVFMALTGV 205
            ||   .|.:|||.|.:. :|:..|..:.|||.::|..:.|:|:| :.|||.......:..|:.|:
plant   108 SS---TVSEWGLICGDK-YKVGLVQALFFAGCMIGAGVFGHLSDSKLGRKGSLTVVCIINAIFGI 168

  Fly   206 AQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEALL-GLSV 269
            |.|.|.:|.:::....|....|.||...||::..|.:||.||.::.:...||::.|.|:| |::.
plant   169 ATAFSPNYWTYVVLRFLTGFSTGGVGLTAFVLATEPIGPSKRGVAGMSTFYFFSAGIAVLSGIAY 233

  Fly   270 FLPDWRQLQLALSVPPLICVAYFWL-----VPESVRWLLARNRREQAGVIIRRAAKVNRRDISVE 329
            ....||:|.:..|:|.|:    |.|     :.||.||.|.|.:.::|..::...||.|.|.|...
plant   234 VFRSWRELFIVSSLPSLL----FLLIVIPFISESPRWYLVRGKVDEAMKLMHSIAKTNGRHIPAG 294

  Fly   330 LMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYG 394
            :..:.           :||||.. :.:::..:..::|:|..|.::..|..|.:.|....:|||||
plant   295 VTLAL-----------DDDVENN-NGERNTAVEGSLKDVILSPLMRMRLVISVAISFTVSIVYYG 347

  Fly   395 LSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVTLAQG 459
            ||||..:|..|.|||..:..:.|:|.:::..:.|.::||:....|:.....:.|:. ||.....|
plant   348 LSLNVGNLKTNLYLNVFVNAVSEMPAFAITAVLLDKYGRKPLSIGTQWFSCVFCLV-GFSVWGAG 411

  Fly   460 DW--IPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTF 522
            .|  :...:||                  :|..|:..::.:::.:.||:.|||:|:..:|..:..
plant   412 PWKSVRMVSGV------------------LGIFGMAGTYNLLFIYIAELFPTVVRNAALGCATQA 458

  Fly   523 ARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTV 574
            |:.||:|||||.:|.   :.||..:|....||.|.|:..||||.|:.|.||:
plant   459 AQMGAILAPFVVVLG---EELPFGVFAVCGLVGGGLAFYLPETLNKPLYDTM 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 155/559 (28%)
MFS 158..533 CDD:119392 108/384 (28%)
OCT4NP_188702.2 2A0119 43..506 CDD:273328 155/559 (28%)
MFS 124..496 CDD:119392 117/410 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I994
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 1 0.910 0.889 Consistency score
55.070

Return to query results.
Submit another query.