DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and Orct2

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001262907.1 Gene:Orct2 FlyBaseID:FBgn0086365 Length:567 Species:Drosophila melanogaster

Alignment Length:587 Identity:191/588 (32%)
Similarity:317/588 (54%) Gaps:75/588 (13%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGAN 77
            :.:|:.::.:|:|||:|:..|.||||..:..|.:.|:.||....|.:||.:|       .|.|::
  Fly     1 MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALP-------FENGSS 58

  Fly    78 -------WVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERC 135
                   | :::.|.: .:..::.....|.:: ||....||:                  ||:.|
  Fly    59 YDLPTHLW-NLSYPEN-ERCSYYDVDYTEEYL-NGSIPRSSN------------------ETKTC 102

  Fly   136 NQFVYGSSE--RTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCIV 198
            :.:||..|:  .:.|.:|.|.|..: :..|...::...|:::|:.:.|.|:|:||||.|....:|
  Fly   103 SSYVYDRSKYLNSAVTEWNLVCGRD-FMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLV 166

  Fly   199 FMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEA 263
            ...|.||...::.:|.::.|..|:....||||:.:|:::.:|||||.||..:.|.:..|::||..
  Fly   167 IQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFM 231

  Fly   264 LLGL-SVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRDIS 327
            |..: :.|:.|||.||:||::|.||.:.|:|::|||.||||.:.|::.|...:::||:.|:.:||
  Fly   232 LTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEIS 296

  Fly   328 VELMASFKQQELDAETGQEDDVEGGLHVKKDDK-----IW--LAVKEVARSHILMGRYAILLLIW 385
            .|.::..    ||.....|:..:..|..::.|:     :|  .....:.|..:|      :.|.|
  Fly   297 DEALSEL----LDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLL------IFLDW 351

  Fly   386 AVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVA 450
            .|.:.||||||.|.::|.||..|||.:...||||.|....|.|.|:|||..|.|.|::..::.:|
  Fly   352 LVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLA 416

  Fly   451 SGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGG 515
            :..:.             :..|:      |:|...::|||.||:|:..:|.|:||..|||:|:..
  Fly   417 TVIIP-------------QRMHT------LIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVA 462

  Fly   516 VGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEEAIAL 580
            :|..|..||...|:|||:..||:.:.|||||:.|:|:|||||||||||||.|:.:.:|:.:....
  Fly   463 LGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERF 527

  Fly   581 GK 582
            ||
  Fly   528 GK 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 187/567 (33%)
MFS 158..533 CDD:119392 127/383 (33%)
Orct2NP_001262907.1 2A0119 11..520 CDD:273328 187/567 (33%)
MFS 127..503 CDD:119392 139/406 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104153024
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I994
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.