DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and T22F7.1

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_497209.1 Gene:T22F7.1 WormBaseID:WBGene00020701 Length:510 Species:Caenorhabditis elegans

Alignment Length:500 Identity:118/500 (24%)
Similarity:212/500 (42%) Gaps:83/500 (17%)


  Fly   102 VANGDHLESSSDPWSAWPL---------------------------DQCFAENFTTETERCNQFV 139
            :::.:.|..::..|..:||                           |:|        ||.|: |.
 Worm    56 ISSVEELLKATTAWRPYPLFIICSMSFLWSLCALSAISPAFTAPAGDEC--------TENCS-FY 111

  Fly   140 YGSSERTIVQQWGLQCPENLWKLAFVGTIHFAG-LVVGTALSGYLADRYGRKHIFLFCIVFMALT 203
            ...:|..:..::.|..|..|     ..:|:|.| |::| .|...:|||:||:.|.:.|::   ||
 Worm   112 TIQNEFNLTSKFFLVEPAEL-----TTSIYFLGNLLIG-QLFAVVADRFGRRPIIIICLL---LT 167

  Fly   204 GVAQALSWDYISFLFFALLNAVGTSGVYPLA---FIIGVEMVGPRKREMSSIVLNYFYAVGEALL 265
            |:..:|.....:|....:...:..|...||.   :::..|.:..|.:.::||.....:..|...|
 Worm   168 GIVGSLGSLAPNFPLLLVARFIQGSCYTPLTTVNYVLSGESIPHRSQSLTSIFFGVSWVCGYCFL 232

  Fly   266 G-LSVFLPDWRQLQLALSVPPLICVAYFWL--VPESVRWLLARNRREQAGVIIRRAAKVNRRDIS 327
            . |||:...||.||||.::|.:: ||.|.:  :||||.:.:.:..|:.....|:|...::.:.::
 Worm   233 APLSVWFNTWRSLQLATALPNIL-VAVFLMGTLPESVGYSIEKKNRKAVQKWIKRNELLSCKKLN 296

  Fly   328 VELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVY 392
            .:|....::.|..| |......:..|      .|:..::|:.....:..|..:...:|.:..:.|
 Worm   297 YDLDMIMEKTEKIA-TSSSPTPQNRL------TIFEMIREILSDREITRRIIVETFLWILTFMTY 354

  Fly   393 YGLSLNATSLSGNK--YLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVT 455
            ..|||.:||: ||.  .::|....:||:|.|....:.|.|..||    .:..||..|    |.:.
 Worm   355 CALSLTSTSV-GNSDPLVSFLFSGVVELPAYLFIPICLTRTKRR----PTRFLCHFT----GSMA 410

  Fly   456 LAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMS 520
            |....::...|.            |.:.::||.|...:..:...:.:.||:.||..||..:||.|
 Worm   411 LLTMYFLSNDTS------------LHLIIWLVAKFCASCCYIFCFIYAAELFPTWCRSCCIGVCS 463

  Fly   521 TFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPET 565
            |....||::||.:.|:.|.......|:...:.|:...|:....||
 Worm   464 TCCNIGAIVAPHIFLIDSAAPGAQFLVLAAVGLLCSGLTWCQQET 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 118/500 (24%)
MFS 158..533 CDD:119392 98/384 (26%)
T22F7.1NP_497209.1 MFS 75..503 CDD:119392 112/475 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102426411
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.