DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and CarT

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_610052.1 Gene:CarT FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster

Alignment Length:613 Identity:182/614 (30%)
Similarity:284/614 (46%) Gaps:100/614 (16%)


  Fly     2 SAPAAGAASAVLDFDDILVEIGEFGRFQRRNYLLICLPVL----FAAANSLSYVFTAGSP-TYRC 61
            |.|:...|   .|.||:|..|||||::|:.....||||..    |.|.|.|   |.|.:| .|.|
  Fly    26 SQPSVDEA---FDLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQL---FMADTPDDYWC 84

  Fly    62 YVPEC-------------------DKLVDAE---YGANWVSIAVPGSWSKRGHFTPSTCERFVAN 104
            .:||.                   |:||.::   ||.||..:...|                  .
  Fly    85 RIPELLDLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQLLESG------------------E 131

  Fly   105 GDHLESSSDPWSAWPLDQCFAENFTTETERCNQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIH 169
            .|.| ::.:|.::|||.:|      .:....|..|..||   ||..:.|.|.::::....:..::
  Fly   132 EDDL-TTMEPNASWPLIKC------PQGWEYNTSVVWSS---IVIDFDLVCDQDIYPTIGLAALN 186

  Fly   170 FAGLVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLA 234
            ..| .||..|.|.|.||.||:..:..|:..:....:..:||.|:.::....::..:....||.:.
  Fly   187 TGG-PVGVYLFGLLNDRGGRRLSYFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIP 250

  Fly   235 FIIGVEMVGPRKREMSSIVLNYFYAVGEALL-GLSVFLPDWRQLQLALSVPPLICVAYFWLVPES 298
            |||.:|:||...|...:::...||..|..|| |::....||.:|....|:|......|.:::|||
  Fly   251 FIISLELVGENYRSFVTVMTCTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPES 315

  Fly   299 VRWLLARNRREQAGVIIRRAAKVNRRD----ISVELMASFKQQELDAETGQEDDVEGGLHVKKDD 359
            .||||.|.|.|:|..|:.|.||||.|:    :.::|.|..::.:|..:.            ||..
  Fly   316 PRWLLMRGRLEEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQK------------KKMA 368

  Fly   360 KIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLA 424
            .:.||  ::.|:..:..:..::.|.|..|..||.|||....:|..|:|::|.|..:||:|.|...
  Fly   369 NVGLA--DLCRTPNMRLKTILITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCC 431

  Fly   425 WLFLRRFGRRVALSGSLLLCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGK 489
            |.|:..:|||..||.|::|..:.||    :|:...|....:|               :.|:||.|
  Fly   432 WYFMDTWGRRWPLSLSMILGGVACV----ITVMLPDDAVDET---------------LVLYLVSK 477

  Fly   490 LGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLV 554
            ..:::||.:||.|..|:.||.:|..|:|..|.....|.:..||:..|......|||::.|.||::
  Fly   478 ALLSASFLIIYPFAGELYPTQVRGIGIGASSYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSML 542

  Fly   555 AGLLSLLLPETFNRKLPDTVEEAIALGK 582
            .|:..|.||||.:.:||.|:||....||
  Fly   543 GGMTGLRLPETLHHRLPQTIEEGEEFGK 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 169/582 (29%)
MFS 158..533 CDD:119392 111/380 (29%)
CarTNP_610052.1 2A0119 44..561 CDD:273328 169/582 (29%)
MFS 182..551 CDD:119392 121/403 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I994
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.