DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and SLC22A24

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001129978.2 Gene:SLC22A24 HGNCID:28542 Length:552 Species:Homo sapiens

Alignment Length:586 Identity:164/587 (28%)
Similarity:274/587 (47%) Gaps:79/587 (13%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYV------FTAGSPTYRCYVP--ECDKL 69
            :.||.:|.::|..||||      |||...|...|.|.:.      |||.:|::||:||  :.|.:
Human     1 MGFDVLLDQVGGMGRFQ------ICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDTV 59

  Fly    70 VDAEYGA----NWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTT 130
            .|.:.|.    :.:.|::|...:.|    |..|:||:    |.:     |....|:..|......
Human    60 SDNDTGTLSKDDLLRISIPLDSNLR----PQKCQRFI----HPQ-----WQLLHLNGTFPNTNEP 111

  Fly   131 ETERC-NQFVYGSSE--RTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHI 192
            :||.| :.:||..|.  .|||.:|.|.|.....| :.|.::..||.::|..:.|:|:||.|||.|
Human   112 DTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLK-SMVQSLFMAGSLLGGLIYGHLSDRVGRKII 175

  Fly   193 FLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYF 257
            ...|.:.:|::....|.:..::.:.....|....|..:....||:.:|...||.|.|:.:||...
Human   176 CKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPRSRSMTIMVLLCS 240

  Fly   258 YAVGEALL-GLSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKV 321
            |:||:.|| ||:..:.||..|||.:|.|.::.....|.:.||.|||:..|:.::....:||.|.:
Human   241 YSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELRRVAHI 305

  Fly   322 N-----RRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAIL 381
            |     ...::.||:.|..::||||.                 :|..::..:.|:..|..|...|
Human   306 NGKKNTEETLTTELVRSTMKKELDAV-----------------RIKTSIFSLFRAPKLRMRVFGL 353

  Fly   382 LLIWAVNAIVYYGLSLNATSLSGNKYLNFALVC-LVEIPGYSLAWLFLRRFGRRVALSGSLLLCS 445
            ..:.....:.:|||.||...|..|..| |.::| .|......::.|.|...|||:    |.:|  
Human   354 CFVRFAITVPFYGLILNLQHLGSNVSL-FQILCGAVTFTARCVSLLTLNHMGRRI----SQIL-- 411

  Fly   446 ITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTV 510
            .|.....|:.:  ..::|.:..:..         :|:....:|.:...|:.|.::  ..|::||:
Human   412 FTFPVGLFILV--NTFLPQEMQILR---------VVLATLGIGSVSAASNSASVH--HNELVPTI 463

  Fly   511 IRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVE 575
            :||...|:.:...|.||.|||.:..|.:|...||.:.:|...::|..:.||||||.:..||:|::
Human   464 LRSTVAGINAVSGRTGAALAPLLMTLMAYSPHLPWISYGVFPILAVPVILLLPETRDLPLPNTIQ 528

  Fly   576 E 576
            :
Human   529 D 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 160/572 (28%)
MFS 158..533 CDD:119392 101/382 (26%)
SLC22A24NP_001129978.2 2A0119 11..526 CDD:273328 160/572 (28%)
MFS 125..516 CDD:119392 117/429 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104107011
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.